KEGG   Pectobacterium parmentieri RNS08.42.1A: A8F97_08285Help
Entry
A8F97_08285       CDS       T04513                                 

Definition
(GenBank) glucose-6-phosphate dehydrogenase
  KO
K00036  glucose-6-phosphate 1-dehydrogenase [EC:1.1.1.49 1.1.1.363]
Organism
ppar  Pectobacterium parmentieri RNS08.42.1A
Pathway
ppar00030  Pentose phosphate pathway
ppar00480  Glutathione metabolism
ppar01100  Metabolic pathways
ppar01110  Biosynthesis of secondary metabolites
ppar01120  Microbial metabolism in diverse environments
ppar01130  Biosynthesis of antibiotics
ppar01200  Carbon metabolism
Module
ppar_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
ppar_M00006  Pentose phosphate pathway, oxidative phase, glucose 6P => ribulose 5P
ppar_M00008  Entner-Doudoroff pathway, glucose-6P => glyceraldehyde-3P + pyruvate
Brite
KEGG Orthology (KO) [BR:ppar00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    A8F97_08285
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    A8F97_08285
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ppar04147]
    A8F97_08285
Enzymes [BR:ppar01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.49  glucose-6-phosphate dehydrogenase (NADP+)
     A8F97_08285
    1.1.1.363  glucose-6-phosphate dehydrogenase [NAD(P)+]
     A8F97_08285
Exosome [BR:ppar04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   A8F97_08285
  Exosomal proteins of colorectal cancer cells
   A8F97_08285
  Exosomal proteins of bladder cancer cells
   A8F97_08285
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: G6PD_C G6PD_N
Motif
Other DBs
NCBI-ProteinID: AOR58904
UniProt: A0A0H3I3C5
Position
complement(1848278..1849753)
Genome map
AA seq 491 aa AA seqDB search
MAVTSTAQACDLVIFGAKGDLARRKLLPSLYQLEKAGHIHADTKIIGVGRADWDKAEYTR
VVREALDTFMKEAIDDKLWETLSGRLDFCNLDVEDTKAFNKLGKMLDQKNRTTINYFAMP
PSTFGAICKGLGTAGLNKDPARVVMEKPLGTDLASSRVINDQVAEFFNECQVYRIDHYLG
KETVLNLLALRFANSLFSSNWDNRTIDHVQITVAEEVGIEGRWGYFDKAGQMRDMIQNHL
LQILTMIAMSPPSDLTTDRIRDEKVKVLRSLRRIDRSNVHETTVRGQYSSGFVQGHKVPG
YLEEEGANKSSSTETFVSIRVDIDDWRWSGVPFYLRTGKRLPTKCSEVVVYFKNPALNLF
HDSYQQLPQNKLIIRLQPDEGVEIQILNKIPGLEHKHRLQTVKLDLSFSETFNQQHLADA
YERLLLETMRGIQALFVRRDEVEEAWKWVDSIMEAWAMDNDAPKPYQAGSWGPVASVAMI
TRDGRSWNEFE
NT seq 1476 nt NT seq  +upstreamnt  +downstreamnt
atggcggtaacttcaacagcccaagcgtgcgatctggttattttcggtgccaagggcgat
ctggcacgccgtaaattgctgccgtccctgtaccagttggaaaaagcagggcacatccat
gcggacaccaagattatcggggtgggccgtgcggattgggataaagcggagtatacccgc
gtcgtgcgcgaagcgcttgacacctttatgaaagaagccatcgacgataagttgtgggaa
acgctaagcggtcggttggatttctgcaatctcgatgtggaagacacaaaagccttcaac
aaactgggcaagatgcttgatcagaaaaatcgtaccaccatcaactactttgcaatgccg
cccagcacatttggtgcgatctgcaaagggctgggaaccgctgggctgaataaagatccg
gcgcgtgtggtgatggaaaaaccgttgggtaccgatctggcatcgtcgcgtgtgattaat
gatcaggtcgcggaattctttaacgaatgtcaggtttaccgcatcgaccactatctgggt
aaagagacggttctgaacctgttggcgctgcgttttgccaattcgttgttctcctcgaat
tgggacaaccggacgatcgaccatgtacagatcacggtagctgaagaagtcggaattgaa
ggccgctggggctattttgacaaagccggtcagatgcgcgacatgatccaaaatcatctg
ttgcagatcctgacgatgattgcgatgtcaccgccgtctgatttgacgactgaccgcatc
cgtgatgaaaaagtgaaagtgttgcgttcactgcgtcgtatcgatcggtccaacgtgcat
gaaacgaccgtgcgcggccaatattcttctggttttgttcagggccataaagtgccgggc
tatctggaagaagaaggcgcgaataaaagcagcagcacggaaaccttcgtctcgattcgt
gtcgacattgatgactggcgctggtctggcgtgccgttctacctgcgcacgggtaaacga
ctgccgacaaaatgttcggaagtggtcgtgtactttaaaaaccctgcgttgaatctgttc
catgattcttaccagcagttaccgcagaacaaactgatcattcgcttgcagccggatgaa
ggcgttgaaattcagattctgaataaaattccaggattagagcacaagcatcgcttgcaa
acggtgaaactggatctgagcttctcggaaacctttaatcagcagcatttggcggatgcc
tatgagcgtctgctgcttgaaaccatgcgtggaattcaggcgttgttcgtccgccgtgat
gaagttgaggaagcctggaagtgggttgattcgatcatggaagcgtgggcgatggacaac
gatgcgccgaagccttatcaggcgggaagctgggggcctgtggcgtccgtggcgatgatc
acgcgcgatggccgttcctggaatgagttcgagtaa

DBGET integrated database retrieval system