KEGG   Pseudomonas putida BIRD-1: PPUBIRD1_0017Help
Entry
PPUBIRD1_0017     CDS       T01975                                 

Gene name
accC
Definition
(GenBank) AccC
  KO
K01959  pyruvate carboxylase subunit A [EC:6.4.1.1]
Organism
ppb  Pseudomonas putida BIRD-1
Pathway
ppb00020  Citrate cycle (TCA cycle)
ppb00620  Pyruvate metabolism
ppb01100  Metabolic pathways
ppb01120  Microbial metabolism in diverse environments
ppb01200  Carbon metabolism
ppb01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:ppb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    PPUBIRD1_0017 (accC)
   00620 Pyruvate metabolism
    PPUBIRD1_0017 (accC)
Enzymes [BR:ppb01000]
 6. Ligases
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.1  pyruvate carboxylase
     PPUBIRD1_0017 (accC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CPSase_L_D2 Biotin_carb_N Biotin_carb_C Dala_Dala_lig_C ATP-grasp RimK ATP-grasp_3 ATP-grasp_4 AP_endonuc_2
Motif
Other DBs
NCBI-ProteinID: ADR57727
Position
complement(15010..16425)
Genome map
AA seq 471 aa AA seqDB search
MIKKILIANRGEIAVRIVRACAEMGIRSVAIFSDADRHALHVKRADEAHSIGAEPLAGYL
NPRKLVNLAVETGCDALHPGYGFLSENAELAEICAERGIKFIGPAADVIRRMGDKTEARR
TMIAAGVPVTPGTEGNVADIHEALSEGDRIGYPVMLKATSGGGGRGIRRCNSREELEQNF
PRVISEATKAFGSAEVFLEKCIVNPKHIEAQILGDSFGNVVHLFERDCSIQRRNQKLIEI
APSPQLTPEQRAYIGDLAVRAAKAVNYENAGTVEFLLADGEVYFMEMNTRVQVEHTITEE
ITGIDIVREQIRIASGLPLSVKQEDIQHRGYALQFRINAEDPKNNFLPSFGKITRYYAPG
GPGVRTDTAIYTGYTIPPFYDSMCLKLVVWALTWEEAMDRGLRALDDMRVQGVKTTAAYY
QEILRNPEFRSGQFNTSFVESHPELTNYSIKRKPEELALAIAAAIAAHAGL
NT seq 1416 nt NT seq  +upstreamnt  +downstreamnt
gtgataaaaaaaatcctgatcgccaaccgaggtgaaatcgcagttcggatcgtgcgtgct
tgcgccgagatgggcattcgctcggtagcgatcttttccgacgccgaccggcatgccttg
cacgtcaagcgcgctgacgaagcacacagcatcggtgccgagccgctggccggttatctg
aacccgcgcaagctggtgaacctggctgtggaaaccggctgtgatgccctgcacccgggc
tatggtttcctttcggaaaacgctgaactggcagaaatttgcgccgagcgcgggatcaag
ttcattggcccggccgccgacgtgattcgccgtatgggcgacaagaccgaagcgcgccgc
accatgatcgccgccggtgtgccggtaaccccgggcaccgaaggcaacgttgccgatatt
catgaagccctgagcgaaggtgaccgcatcggttatccggtgatgctcaaggccacctcc
ggtggtggcggccgcggtattcgccgttgcaatagccgcgaagaactggaacagaacttc
ccgcgggtcatttccgaggcgaccaaggcattcggttcggccgaagtgttcctggagaaa
tgcatcgtcaacccgaagcacatcgaggcgcaaattctcggtgacagcttcggtaacgta
gtgcacctgttcgagcgcgactgctctatccagcgtcgtaaccagaagctaatcgaaatt
gccccgagcccacagctcactcctgagcagcgcgcctacatcggcgacctggcggtgcgt
gcggccaaagcggtgaattacgagaacgccggtaccgtggagttcctgctcgccgatggc
gaagtgtacttcatggaaatgaacacccgggtgcaggtggaacacaccattaccgaggaa
atcaccggtatcgacatcgttcgtgagcagatccgcatcgcctcggggctgccactgtcg
gtcaagcaggaagacattcagcaccgcggctacgccttgcagttccgtatcaatgctgaa
gatccgaaaaacaacttcctgcccagcttcggcaagatcacccgttactacgcccccggc
ggcccgggcgtgcgcaccgacacggcgatctacaccggctataccattccaccgttctac
gactccatgtgcctgaaactggtggtgtgggcgttgacctgggaagaagccatggaccgc
ggcctgcgggccctggacgacatgcgcgtgcaaggggtgaagaccaccgccgcgtactac
caggaaatcctgcgcaatccggaattccgtagcggccagttcaataccagctttgtcgaa
agccaccctgaattgaccaactactcgatcaagcgcaaacccgaagagctggccctggcc
atcgccgccgccattgccgcccacgcaggcctgtga

DBGET integrated database retrieval system