KEGG   Pseudomonas putida BIRD-1: PPUBIRD1_0438Help
Entry
PPUBIRD1_0438     CDS       T01975                                 

Gene name
apaG
Definition
(GenBank) ApaG
  KO
K06195  ApaG protein
Organism
ppb  Pseudomonas putida BIRD-1
Brite
KEGG Orthology (KO) [BR:ppb00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    PPUBIRD1_0438 (apaG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF525
Motif
Other DBs
NCBI-ProteinID: ADR58132
Position
complement(509308..509688)
Genome map
AA seq 126 aa AA seqDB search
MSDPRYQIDVSVVTRYLKEQSDPENSRFAFAYTITVQNNGSLSAKLLSRHWLITNGDGEV
EEVRGAGVVGQQPNIDPGQSHTYSSGAVISTRVGTMQGSYQMFAEDGKRFDAEIAPFRLA
VPGALH
NT seq 381 nt NT seq  +upstreamnt  +downstreamnt
atgtccgacccccgctatcaaatcgacgtcagcgtcgtgacccgctacctgaaagaacaa
tccgaccccgaaaacagtcgcttcgctttcgcctacaccattaccgtgcagaacaacggc
tcgctcagtgccaagttgctgtcgcgccactggctgatcaccaacggtgacggcgaggtt
gaggaagtacgcggcgccggcgtggttggccagcaacccaacatcgaccctggccagagc
cacacttacagcagtggtgccgtcatcagcacccgcgttggcaccatgcagggcagctac
cagatgttcgccgaagacggtaagcgcttcgacgcagagattgcccccttccggctggca
gtgcccggagcgctgcactga

DBGET integrated database retrieval system