KEGG   Pseudomonas putida BIRD-1: PPUBIRD1_0459Help
Entry
PPUBIRD1_0459     CDS       T01975                                 

Gene name
trpC
Definition
(GenBank) TrpC
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
ppb  Pseudomonas putida BIRD-1
Pathway
ppb00400  Phenylalanine, tyrosine and tryptophan biosynthesis
ppb01100  Metabolic pathways
ppb01110  Biosynthesis of secondary metabolites
ppb01130  Biosynthesis of antibiotics
ppb01230  Biosynthesis of amino acids
Module
ppb_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:ppb00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    PPUBIRD1_0459 (trpC)
Enzymes [BR:ppb01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     PPUBIRD1_0459 (trpC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS
Motif
Other DBs
NCBI-ProteinID: ADR58153
Position
534526..535359
Genome map
AA seq 277 aa AA seqDB search
MSVPTVLERIIARKFQEVAERSARVSLAELEGLAKAADAPRGFANALIEQAKRKQPAVIA
EIKKASPSKGVIREHFVPAEIAVSYEKGGATCLSVLTDVDYFQGSDEYLQQARAAVSLPV
IRKDFMVDPYQIVEARALGADCVLLIVSALDDVKMAELAATAKDVGLDVLVEVHDGDELE
RALKTLDTPLVGVNNRNLHTFEVSLETTLDLLPRIPRDRLAITESGILNRADVELMAINE
VYSFLVGEAFMRAEQPGLELQRLFFPEQVKKTVQQLD
NT seq 834 nt NT seq  +upstreamnt  +downstreamnt
atgagtgtgccgacggtgctggaaaggatcattgcccgcaagtttcaggaagtggccgag
cgcagtgcgcgcgtcagcctcgccgaactggagggcctggccaaggccgctgacgccccg
cgaggcttcgccaacgcgctgatcgagcaggccaagcgcaagcagcccgcggtgattgcc
gaaatcaagaaggcttcgccaagcaagggcgtgatccgcgagcacttcgtgccagcggaa
atcgcggtcagctacgagaagggcggggccacctgcctgtcggtgttgaccgatgtcgat
tatttccagggttccgatgagtacttgcagcaggcccgcgcggctgtttcgctgccggtg
atccgcaaggacttcatggtcgacccttaccagatcgtcgaagcccgtgccctgggggca
gattgcgtactgctgatcgtgtcggcgctggatgacgtgaagatggctgaactggccgcc
actgccaaggacgtcggcctcgacgtgctggtggaagtgcacgatggcgatgaactggag
cgcgcgctgaaaacactggacacgccgctggtgggggtgaacaaccgcaacctgcacacc
ttcgaggtcagcctggaaaccacccttgacctgctgccgcgcattccgcgtgaccgtctg
gcgattaccgaaagcggtattctcaaccgggccgatgtggagctgatggcaatcaacgag
gtttactcgttcctggtgggtgaggcgttcatgcgcgctgagcagcctggcctggaatta
cagcggctgttcttccctgagcaggtgaagaagactgttcagcaactggactga

DBGET integrated database retrieval system