KEGG   Pseudomonas putida BIRD-1: PPUBIRD1_0602Help
Entry
PPUBIRD1_0602     CDS       T01975                                 

Definition
(GenBank) Alcohol dehydrogenase
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
ppb  Pseudomonas putida BIRD-1
Pathway
ppb00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:ppb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    PPUBIRD1_0602
Enzymes [BR:ppb01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     PPUBIRD1_0602
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     PPUBIRD1_0602
    1.1.1.-  
     PPUBIRD1_0602
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_N_assoc AlaDh_PNT_C 2-Hacid_dh_C ADH_zinc_N_2 DAO PALP UDPG_MGDP_dh_N
Motif
Other DBs
NCBI-ProteinID: ADR58292
Position
complement(676111..677199)
Genome map
AA seq 362 aa AA seqDB search
MNGLSHTHMRAAVWHGRNDIRVEQVPLPADPAPGWVQIKVDWCGICGSDLHEYVAGPVFI
PVEAPHPLTGIQGQCILGHEFCGHIAKLGEGVEGYAVGDPVAADACQHCGTCYYCTHGLY
NICERLAFTGLMNNGAFAELVNVPANLLYRLPQGFPAEAGALIEPLAVGMHAVKKAGSLL
GQTVVVVGAGTIGLCTIMCAKAAGAAQVIALEMSSARKAKAKEVGANVVLDPSQCDALAE
IRALTAGLGADVSFECIGNKHTAKLAIDTIRKAGKCVLVGIFEEPSEFNFFELVSTEKQV
LGALAYNGEFADVIAFIADGRLDIRPLVTGRIGLEQIVELGFEELVNNKEENVKIIVSPG
VR
NT seq 1089 nt NT seq  +upstreamnt  +downstreamnt
atgaatggcctgagccacacccacatgcgcgctgctgtctggcatggccgcaatgatata
cgtgtcgaacaggtacccttgccggccgaccctgcgccgggctgggtgcagatcaaggtg
gactggtgcggcatctgcggctccgacctgcacgaatatgttgccggcccggtgttcatc
ccggtagaggccccgcacccgctgaccggcattcagggccagtgcatcctcggccatgaa
ttctgcggccacatcgccaagcttggcgaaggcgtggaaggctatgccgtaggcgacccg
gtggcggcagacgcctgccagcattgcggcacctgctattactgcacccatggcctgtac
aacatctgcgaacgcctggcgttcaccggcctgatgaacaacggtgccttcgccgagctg
gtcaacgtgcccgccaacctgctctaccggctgccgcagggcttccctgccgaagccggg
gcactgatcgaaccgctggcggtgggtatgcacgcggtgaaaaaggccggcagcctgctt
gggcaaaccgttgtagtggtgggggccggcaccatcggcctgtgcaccatcatgtgcgcc
aaggctgcgggtgcggcacaggtcatcgcccttgagatgtcctctgcgcgcaaagccaag
gccaaggaagttggcgccaacgtggtgctggaccccagccagtgcgatgccctggcggaa
atccgcgcactgactgcagggctgggcgccgatgtgagttttgagtgcatcggcaataaa
catacggccaagctggccatcgacaccatccgcaaggcgggcaaatgcgtgctggtgggt
attttcgaagagcccagcgagttcaacttcttcgagctggtgtccaccgagaaacaggtg
ctgggggcgttggcgtacaacggcgagtttgccgacgtgattgccttcattgctgatggt
cggctggatattcgcccgctggtaaccggccggatcgggttggaacagattgtcgagctg
ggcttcgaggaactggtgaacaacaaagaggagaacgtgaagatcatcgtttcaccaggt
gtgcgctga

DBGET integrated database retrieval system