KEGG   Pseudomonas putida BIRD-1: PPUBIRD1_0632Help
Entry
PPUBIRD1_0632     CDS       T01975                                 

Definition
(GenBank) Acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
ppb  Pseudomonas putida BIRD-1
Pathway
ppb00071  Fatty acid degradation
ppb00072  Synthesis and degradation of ketone bodies
ppb00280  Valine, leucine and isoleucine degradation
ppb00310  Lysine degradation
ppb00362  Benzoate degradation
ppb00380  Tryptophan metabolism
ppb00620  Pyruvate metabolism
ppb00630  Glyoxylate and dicarboxylate metabolism
ppb00640  Propanoate metabolism
ppb00650  Butanoate metabolism
ppb00900  Terpenoid backbone biosynthesis
ppb01100  Metabolic pathways
ppb01110  Biosynthesis of secondary metabolites
ppb01120  Microbial metabolism in diverse environments
ppb01130  Biosynthesis of antibiotics
ppb01200  Carbon metabolism
ppb01212  Fatty acid metabolism
ppb02020  Two-component system
Brite
KEGG Orthology (KO) [BR:ppb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    PPUBIRD1_0632
   00630 Glyoxylate and dicarboxylate metabolism
    PPUBIRD1_0632
   00640 Propanoate metabolism
    PPUBIRD1_0632
   00650 Butanoate metabolism
    PPUBIRD1_0632
  09103 Lipid metabolism
   00071 Fatty acid degradation
    PPUBIRD1_0632
   00072 Synthesis and degradation of ketone bodies
    PPUBIRD1_0632
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    PPUBIRD1_0632
   00310 Lysine degradation
    PPUBIRD1_0632
   00380 Tryptophan metabolism
    PPUBIRD1_0632
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    PPUBIRD1_0632
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    PPUBIRD1_0632
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    PPUBIRD1_0632
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ppb04147]
    PPUBIRD1_0632
Enzymes [BR:ppb01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     PPUBIRD1_0632
Exosome [BR:ppb04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   PPUBIRD1_0632
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: ADR58322
Position
714563..715840
Genome map
AA seq 425 aa AA seqDB search
MRSTRRVAILGGNRIPFARSNGAYATASNQAMLTAALEGLIERYRLHGLRLGEVVAGAVL
KHSRDMNLTRECVLGSRLSPQTPAYDIQQACGTGLEAALLVANKIALGQIDCGIAGGVDS
TSDAPIAVNEGLRHILLQANRGKSLGERFKPFLKLRPHHLKPELPRNSEPRTGLSMGEHC
ERMAHTWRVARAEQDELAVLSHQKLAAAYAEGWQDDLLTPFLSLIRDNNLRPDLSLEQLA
RLKPAFDRSGQGTLTAGNSTPLTDGASLVLLSSEAWAQQQGLQVLAYLVDGETAAVDFVT
GREGLLMAPVYAVPRLLARNGLTLQDFDYYEIHEAFAAQVLCTLKAWEDADYCRERLGLE
APLGAIDRSKLNVKGSSLAAGHPFAATGGRILASLAKLLATAGKGRGLISICAAGGQGVT
VIVER
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atgcgttcaactcgccgggtcgcgattctgggcggcaaccggatccctttcgcccgctcc
aatggcgcctacgctacggccagcaaccaggcgatgctcacggccgcgcttgaaggcttg
atcgaacgctatcgcttgcacgggctgcggttgggcgaggtggtggccggtgcggtgctc
aagcactcgcgcgacatgaacctgacccgcgagtgcgtgttgggttcgcgcctgtcaccg
cagaccccggcctatgacatccagcaggcctgcggtaccgggctggaggctgcgctgctg
gtggccaacaagattgccctggggcagatcgactgcggtatcgctggcggtgtcgacagc
acctccgatgcgccgatcgccgtcaacgaaggcttgcgccatatattgctgcaggccaac
cgtggtaaaagccttggcgagcggttcaagcctttcctcaagctacggcctcaccacctg
aaacccgagctaccacgcaatagcgagccgcgtacggggttgtcgatgggcgagcattgc
gagcgcatggcccacacctggcgcgttgcccgcgccgagcaggacgaattggcggtgctt
agccaccagaagctggccgcagcctatgccgagggttggcaggacgacctgttgacgccg
tttctttcgctgatacgggacaacaacctgcgccccgaccttagccttgagcagttggcc
agactcaaaccagcctttgaccgcagcgggcagggcacgttgacggccggtaattccacg
ccgttgaccgatggtgcttcgctggtgctgttaagcagtgaggcgtgggcgcagcagcag
gggttgcaggtgcttgcctatctggtcgatggcgaaaccgctgcggtggattttgtcacg
gggcgcgaagggttgttgatggcgccggtgtatgccgtgccgcgcttgctggcacgcaat
ggcctgacgctgcaggactttgactattacgaaatccacgaagcctttgctgcccaggtg
ctgtgcacgctcaaggcctgggaggatgccgattactgccgtgagcggttgggcctggag
gcgccgcttggcgccatcgaccgcagcaaactcaacgtcaagggcagttcgctggcggcc
gggcacccgtttgcggcaaccggtgggcggatattggccagcctggccaaactgctggcg
acggcgggtaaggggcgcgggctgatttcgatctgtgcggcaggcgggcaaggggtgacc
gttatcgtcgagcgctga

DBGET integrated database retrieval system