KEGG   Pseudomonas putida BIRD-1: PPUBIRD1_1411Help
Entry
PPUBIRD1_1411     CDS       T01975                                 

Gene name
phhA
Definition
(GenBank) PhhA
  KO
K00500  phenylalanine-4-hydroxylase [EC:1.14.16.1]
Organism
ppb  Pseudomonas putida BIRD-1
Pathway
ppb00360  Phenylalanine metabolism
ppb00400  Phenylalanine, tyrosine and tryptophan biosynthesis
ppb00790  Folate biosynthesis
ppb01100  Metabolic pathways
ppb01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:ppb00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00360 Phenylalanine metabolism
    PPUBIRD1_1411 (phhA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    PPUBIRD1_1411 (phhA)
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    PPUBIRD1_1411 (phhA)
Enzymes [BR:ppb01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.16  With reduced pteridine as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.16.1  phenylalanine 4-monooxygenase
     PPUBIRD1_1411 (phhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Biopterin_H
Motif
Other DBs
NCBI-ProteinID: ADR59085
Position
complement(1579356..1580144)
Genome map
AA seq 262 aa AA seqDB search
MKQTQYVAREPDAHGFIDYPQQEHAVWNTLITRQLKVIEGRACQEYLDGIDQLKLPHDRI
PQLGEINKVLGATTGWQVARVPALIPFQTFFELLASKRFPVATFIRTPEELDYLQEPDIF
HEIFGHCPLLTNPWFAEFTHTYGKLGLAATKEQRVYLARLYWMTIEFGLMETAQGRKIYG
GGILSSPKETVYSLSDEPEHQAFDPIEAMRTPYRIDILQPVYFVLPNMKRLFDLAHEDIM
GMVHKAMQLGLHAPKFPPKVAA
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atgaaacagacgcaatacgtggcacgcgagcccgatgcgcatggttttatcgattacccg
cagcaagagcatgcggtttggaacaccttgatcacccgccagctgaaagtgatcgaaggc
cgtgcgtgccaagagtacctggacggcatcgaccagctgaaattgccgcatgaccgcatt
ccgcaactgggcgagatcaacaaggtgctgggtgccaccaccggctggcaggttgcccgg
gttccggcgctgatccccttccagaccttcttcgaattgctggccagcaagcgctttccg
gttgccaccttcatccgcaccccggaagagctggactacctgcaagagccggatatcttc
cacgaaatcttcggccactgcccgctgctgaccaatccctggttcgccgagttcactcac
acctacggcaagctcggcctcgccgcgaccaaggaacaacgcgtgtacctggcgcgcctg
tactggatgaccatcgagtttggcctgatggaaaccgcgcaaggccgcaaaatctatggc
ggcggcatcctctcgtcaccgaaagagaccgtctacagtctgtctgacgagcccgagcac
caggccttcgacccgatcgaggccatgcgtacgccctaccgcatcgacattctgcaaccg
gtgtatttcgtgctgccgaacatgaagcgcctgttcgacctggcccacgaggacatcatg
ggtatggtccacaaagccatgcagctgggtctgcacgcaccgaagtttccacccaaggtc
gctgcctga

DBGET integrated database retrieval system