KEGG   Pseudomonas putida BIRD-1: PPUBIRD1_1844Help
Entry
PPUBIRD1_1844     CDS       T01975                                 

Definition
(GenBank) Gluconolactonase
  KO
K13874  L-arabinonolactonase [EC:3.1.1.15]
Organism
ppb  Pseudomonas putida BIRD-1
Pathway
ppb00053  Ascorbate and aldarate metabolism
ppb01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ppb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00053 Ascorbate and aldarate metabolism
    PPUBIRD1_1844
Enzymes [BR:ppb01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.15  L-arabinonolactonase
     PPUBIRD1_1844
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SGL PD40 Phytase-like
Motif
Other DBs
NCBI-ProteinID: ADR59507
Position
complement(2099368..2100276)
Genome map
AA seq 302 aa AA seqDB search
MQNASMTAELIIDARNVTGESPVWHPQENALYWVDIPVGRLHRWQPDGQTHHWTADEMLG
CIARSHRGHWLGAQESGIFHLTPQADGRLLAGKRASVEHARPGMRLNDGRCDRQGRFWAG
TMQTSMAAEPVGALYRYDAMADGTAGPLQARLGTLSVPNGMAFSPDGKTMYVSDSHPSVQ
MIWAFDYDIDSGSPHNRRVFVDMNQHPGRPDGAAVDAEGCYWICAIDAGQVLRFTPDGKL
DRALPLPVKKPTMCAFGGPQLETLFVTSIRPQGIDLSDQPLAGGVFALTPGVKGLPEPIA
KG
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
gtgcagaatgcttccatgacagccgaactgattatcgatgcacgcaatgtcacgggcgag
agcccggtctggcacccgcaggaaaatgccttgtactgggtggacattccggtaggccgc
ctgcaccgctggcaaccggacggccagacccaccactggaccgcagacgaaatgctaggc
tgcattgcccgcagccaccgaggccattggctgggggcccaggagagcgggatcttccac
ctcaccccccaggcagacggccgtctgctggccggcaagcgtgccagtgtcgaacacgcc
aggcccggcatgcgcctcaatgacgggcgctgtgaccgccaggggcgcttctgggccggt
acgatgcaaaccagcatggccgccgagccggtgggtgccttgtaccggtatgacgcgatg
gcagatggcacggcagggccattgcaggcacggctgggcacattgtccgttccaaacggc
atggcgttcagcccggacggcaaaaccatgtacgtctccgactcacacccgagcgtgcag
atgatctgggctttcgactacgacatcgatagcggcagcccgcacaaccgccgggtcttc
gtcgacatgaaccagcaccccggccggccggatggggctgcggtagatgccgaaggttgc
tactggatctgtgcgatcgatgccggccaggtactgcgctttactcccgacggcaagctg
gaccgcgccctgccgctaccggtgaagaaacctaccatgtgcgcattcggtggcccgcaa
ctggaaacgttgttcgtgacgtcgattcgcccgcaaggcatcgacctgagcgaccagccc
ctggccggtggcgtgttcgcattgacccctggcgtcaaaggcttgccggagcccatcgcc
aagggctga

DBGET integrated database retrieval system