KEGG   Pseudomonas putida BIRD-1: PPUBIRD1_3048
Entry
PPUBIRD1_3048     CDS       T01975                                 

Definition
(GenBank) ATPase
Organism
ppb  Pseudomonas putida BIRD-1
SSDB
Motif
Pfam: AAA_2 ClpB_D2-small AAA_5 AAA Sigma54_activat AAA_16 AAA_22 AAA_33 AAA_18 AAA_30 RNA_helicase AAA_23 Rad17 AAA_6 AAA_7 TsaE
Other DBs
NCBI-ProteinID: ADR60657
Position
complement(3415657..3416778)
AA seq 373 aa
MPFLNDLLEQTRRDASSSAALSAENCHTRAIVETHLRSEDTLQSRFRFDVAAVMQVVRNE
VLGQDEALQAIEDVLTVVRADILDPRRPLFTALFLGPTGVGKTEVVRALARALHGDADAF
CRVDMNTLAQEHYAAALTGAPPGYAGAKEGRTLFDQALLDGSQGRPGIVLFDELEKASKE
VSQALLNVFDNGLLRLASGEKSFNFRNTLVFMTSNLAADEIRQHRLGPLAPLRRLLGLQA
GRRERLLGLVRRRLVKRFSAEFVNRIDSTVVFNAIEQEVSERIIELEVSRLNRRLAKHHC
RLQLDAAVVGKLASEGHDLEFGARALKRFIRHELEVPLAEYLLGNRIPCQAEVTCMTVAG
HLERGRIRFSLPT
NT seq 1122 nt   +upstreamnt  +downstreamnt
atgccgttcttgaatgacctgctggagcagacgcgtcgcgatgcgtcctccagtgctgca
ctgagtgccgaaaactgccacacccgggcaatcgtcgagacccacctgcgcagtgaagac
accctgcagtcgcgtttccgcttcgatgtcgctgccgtcatgcaggtagtacgcaacgaa
gtgctgggccaggacgaagccttgcaggccatcgaagatgtgctcacggtggtgcgtgcg
gatattctcgacccgcgccgcccgctgttcacggcattgttcctcggcccgaccggggtc
ggcaagaccgaggtcgtgcgtgccctggcccgcgccctgcacggtgatgccgatgccttc
tgccgggtcgacatgaacacgctggcccaggaacactacgccgctgctctgaccggcgca
ccaccgggctatgctggcgccaaggaaggccgcacgctgtttgaccaggcgctgctggac
gggagccaagggcgcccagggatcgtgctgttcgatgagctggagaaggccagcaaggag
gtgtcccaggcgctgctcaatgtgttcgacaatggcctgctgcgcttggcctccggtgaa
aagagcttcaatttccgtaacacactggtgttcatgaccagcaacctggcggcagacgaa
atacgccagcaccggctgggcccgctggcgccgctgcggcgtctgcttggcctgcaggca
gggcgccgcgagcgtttgctggggttggtgcggcggcgcctggtgaagcgtttttctgcc
gagttcgtcaaccgcatcgacagcactgtggtgttcaatgccatcgaacaggaggtgagc
gagcgcatcattgaactggaggtgtcgcgcctgaaccggcgtcttgccaagcatcactgc
cgcctgcagctggatgcggcggtggttggcaagctggccagcgaaggccatgacctggag
tttggcgcgcgtgcactcaagcgctttatccgccatgagctggaagtgccactggccgag
tacctgcttggtaaccgcatcccatgccaggcagaagtgacgtgcatgacggtggccggc
caccttgagcgcgggcgcatccgtttttcgttgccgacatga

DBGET integrated database retrieval system