KEGG   Pseudomonas putida BIRD-1: PPUBIRD1_3064
Entry
PPUBIRD1_3064     CDS       T01975                                 

Definition
(GenBank) ImpA domain-containing protein
  KO
K11910  type VI secretion system protein VasJ
Organism
ppb  Pseudomonas putida BIRD-1
Brite
KEGG Orthology (KO) [BR:ppb00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:ppb02044]
    PPUBIRD1_3064
Secretion system [BR:ppb02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   PPUBIRD1_3064
SSDB
Motif
Pfam: T6SS_VasJ ImpA_N
Other DBs
NCBI-ProteinID: ADR60672
Position
complement(3438827..3440290)
AA seq 487 aa
MSVVAQVSGEEVTRLLAPIDPAVPAGLFDVEDETYQAIDQEMVKLGGLQEASIDWVYIED
ASRQYLGLQCKHLRIVAHLSAAWLRSGCWERWGCTLALLAGMLECYWEAAHPKPGPKGFL
GKRKLVALVIDRLAEALPRLDRFTYTPTHAAAAQAALKRLQQQETVQLDTAALGELERLL
GKYSELASGGGEAAVPKAPAATEKPAPLADVIATPVSRMSMGNERETRRAVLSMAELINQ
QDPYDATGYQLRRFGLWAHIQVAPQVRQGNRTELMAVPLDITRVYEEAIASQVVDPALLQ
RIEKSLTACPFWIRGSFLAATVATQLAMCEVAEAIRCATARFVQRMPSLQQLCFSDGLVF
VDDQCLAWLKGTQGPSGQGATPQEFSGLREELVSQLETGGVEPLLLRLQGLQAGFRAPRE
RCHTTVIAADLLAARGVSWLAQDLCASVARTMQQTTASAWEPEVFQRLQQYAASPALAVQ
DKDQEPR
NT seq 1464 nt   +upstreamnt  +downstreamnt
atgtcggtggtagcgcaggtatccggggaagaggtcactcggttgctcgcgccgattgat
ccggcagttccggctggcctgttcgatgtcgaggacgaaacctaccaggccattgatcag
gagatggtcaagctgggtgggctgcaggaagcctcgatcgactgggtctacatcgaagac
gcgtcccgtcagtacctgggcctgcagtgcaagcacttgcgaatcgttgcgcacctgagt
gccgcatggttgcgtagcggctgctgggagcggtgggggtgcaccttggcgttgctggcc
ggcatgctcgagtgctattgggaggccgctcatcccaagccgggaccgaaaggcttcctg
ggcaagcgcaagctggttgccctggtgatcgatcgcttggccgaggcgctcccgcgtctt
gatcgttttacctacaccccgacccacgcagcggcagcgcaggctgccttgaaacgcttg
caacaacaggaaacggtgcagctggacacggcagcactgggcgaacttgagcgcctgcta
ggcaaatactcggaacttgccagcggtggcggcgaggctgctgtgcccaaagcgccggct
gcaaccgagaagcctgcaccgttggccgatgtcatcgccacacccgtgtcacgcatgtcg
atgggcaatgagcgtgagacacgccgggccgtgctgtccatggccgagctcatcaaccag
caggatccttacgacgctaccggctaccagttacggcgtttcggtctgtgggcgcacatt
caggttgctccccaagtcaggcagggcaaccgtacggaattgatggcggtgccgctggat
atcacgcgggtctatgaagaggccatagccagtcaggtggttgaccccgccttgctgcag
cgcattgaaaagagcctgacggcttgccccttctggattcgtggcagctttctggctgcg
accgtcgccacacagctggcgatgtgcgaggtggccgaggccatccgttgtgccaccgcc
cggtttgtacagcgtatgccgtcgctgcagcagttgtgcttcagcgacgggctggtattt
gtcgatgaccagtgcctggcctggctcaagggcacgcaagggccgtcaggccaaggtgca
accccccaggagttcagcggtctgcgcgaggagctggtcagccagctggaaaccggtggc
gtagaaccgctgctccttcggctgcaagggctgcaagcgggctttcgtgctccccgtgag
cgttgccacaccacggtgattgcagccgatctgctggccgcgcggggtgtgtcctggctg
gcccaggacctatgcgccagcgttgcccgaaccatgcagcaaaccaccgccagtgcgtgg
gagcccgaggtatttcagcggcttcagcagtacgccgcatccccagcgctggcagttcaa
gacaaggatcaggagcctcgatga

DBGET integrated database retrieval system