KEGG   Pseudomonas putida BIRD-1: PPUBIRD1_3350Help
Entry
PPUBIRD1_3350     CDS       T01975                                 

Definition
(GenBank) Aconitate hydratase
  KO
K20455  2-methylcitrate dehydratase (2-methyl-trans-aconitate forming) [EC:4.2.1.117]
Organism
ppb  Pseudomonas putida BIRD-1
Pathway
ppb00640  Propanoate metabolism
ppb01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ppb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    PPUBIRD1_3350
Enzymes [BR:ppb01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.117  2-methylcitrate dehydratase (2-methyl-trans-aconitate forming)
     PPUBIRD1_3350
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aconitase Aconitase_C
Motif
Other DBs
NCBI-ProteinID: ADR60946
Position
complement(3745891..3748482)
Genome map
AA seq 863 aa AA seqDB search
MMNTAYRKHLPGTDLDYFDARAAVEAIKPGAYDGLPYTSRVLAENLVRRCDPATLDASLS
QLIERKRDLDFPWFPARVVCHDILGQTALVDLAGLRDAIADKGGDPAQVNPVVPVQLIVD
HSLAVECGGFDPQAFEKNRAIEDRRNEDRFHFINWTKKAFKNVDVIQPGNGIMHQINLEK
MSPVVHSDRGVAYPDTCVGTDSHTPHVDALGVIAIGVGGLEAENVMLGRASWMRLPEIVG
VELTGKLAPNITATDLVLALTEFLRKQKVVGAYLEFHGEGARALTLGDRATISNMAPEYG
ATAAMFAIDQQTIDYLRLTGREEQQVKLVETYAKATGLWADSLGGAVYERTLSFDLSSVV
RNMAGPSNPHARVATSDLAAKGIAGRWEEVPGQMPDGAVIIAAITSCTNTSNPRNVIAAG
LIARNANKLGLTRKPWVKSSLAPGSKAVQLYLEEAGLEKELEQLGFGIVAFACTTCNGMS
GALDPVIQQEIIDRDLYATAVLSGNRNFDGRIHPYAKQAFLASPPLVVAYAIAGTIRFDI
EKDVLGVVNGKEIRLKDIWPSDEEIDAVVRAAVKPEQFRKVYIPMFAIEEDRGPKVAPLY
DWRPMSTYIRRPPYWEGALAGERTLRGMRPLAVLPDNITTDHLSPSNAIMLDSAAGEYLA
KMGLPEEDFNSYATHRGDHLTAQRATFANPKLFNEMVRNEDGSVKQGSLARIEPEGKVTR
MWEAIETYMQRKQPLIIVAGADYGQGSSRDWAAKGVRLAGVEAIVAEGFERIHRTNLVGM
GVLPLEFKPGTDRKTLGLDGSETYDVLGARTPRATLTLVVTRANGERLEVPVTCRLDTAE
EVSIYEAGGVLQRFAQDFLEATA
NT seq 2592 nt NT seq  +upstreamnt  +downstreamnt
atgatgaacactgcataccgcaagcacctgccaggcaccgacctggactacttcgatgcc
cgcgcggcggtcgaggcgatcaagcccggcgcctacgacggcttgccttacacgtcccgc
gtgctcgccgagaacctggtgcgccgctgcgaccctgctacgctcgacgcctcgctgagc
cagctgatcgaacgcaagcgcgacctcgacttcccgtggttcccggcccgcgtggtgtgc
catgacatcctcggccagactgcgctggtcgaccttgccggcctgcgtgacgccattgcc
gacaaaggcggcgacccggcccaggtcaacccggtggtgccggtgcaactgatcgtcgac
cactcgctggccgtcgagtgcggtggtttcgacccgcaggccttcgaaaagaaccgtgcc
atcgaagaccgccgcaacgaagaccgcttccacttcatcaactggaccaagaaggcgttc
aagaacgtcgacgtgatccagccgggcaacggcatcatgcaccagatcaacctggagaag
atgtcaccggtggtccacagcgaccgtggcgtcgcctacccggacacctgcgtcggcacc
gacagccacacgccgcatgtcgatgcactgggtgtgatcgccatcggcgtaggtggcctg
gaagccgaaaacgtgatgctcggccgcgcctcctggatgcgcctgccggaaatcgtcggc
gtcgagctgactggcaagctggccccgaacatcaccgccactgacctggtactggccctg
accgagttcctgcgcaagcagaaagtggtcggcgcttacctggagttccatggtgaaggt
gcccgcgccctgaccttgggcgaccgcgccaccatttccaacatggccccggaatacggc
gccacggcggcgatgttcgccatcgaccagcagaccatcgactacctgcgcctgaccggc
cgtgaagagcagcaggtcaaacttgtggaaacctacgccaaggccaccggcctgtgggct
gacagcctgggcggcgcggtctacgagcgtaccctgagcttcgacctgtcgagcgtggta
cgcaacatggccggcccgtccaacccgcatgcccgcgtcgccaccagcgacctggcagcc
aaaggcatcgccggcagatgggaagaagtgccggggcagatgccggacggcgcggtaatc
atcgctgccatcaccagttgcaccaacaccagcaacccgcgcaacgtgattgccgcaggc
ctgattgcgcgcaatgccaacaagctgggcctgacccgcaagccgtgggtcaagtcgtcg
ctggcacccggctccaaggccgtgcagctgtacctggaggaagcagggctggagaaggag
ctggagcaacttggcttcggcatcgtcgccttcgcctgcaccacctgcaacggtatgtcc
ggcgccctggacccggtgatccagcaagaaatcatcgaccgcgacctgtacgccactgcc
gtgttgtcgggtaaccgcaacttcgacgggcgtatccacccgtacgccaagcaggccttc
ctggcctcgccaccactggtggtggcctatgccattgccggtaccattcgtttcgacatc
gagaaggatgtgctgggcgtggtcaatggcaaggaaatccgcctcaaggacatctggccc
agcgacgaagaaatcgatgcggtggtacgtgcagcggtcaagccggagcaattccgcaag
gtgtacatcccgatgttcgccatcgaggaagaccgcgggccgaaagttgcgccgctgtat
gattggcgcccgatgagcacctacatccgccgccctccctactgggaaggtgccctggcc
ggcgaacgcacgttgcgtggcatgcgcccgctggcggtgctgccggacaacatcaccacc
gaccacctgtcgccgtccaacgccatcatgctcgacagcgccgccggcgaatacctggcg
aaaatgggcctgccggaagaagacttcaactcctacgctacccaccgtggcgaccacctg
accgcccagcgcgccaccttcgccaaccccaagctgttcaacgaaatggtgcgcaatgaa
gatggcagcgtgaagcagggctcgctggcgcgtatcgagccggaaggcaaggttacccgc
atgtgggaggcgatcgagacctacatgcagcgcaagcagccgctgatcattgtcgccggt
gccgactacggccaaggttcgtcccgtgactgggcggccaagggcgtgcggctggccggt
gtcgaggcgatcgtggccgaaggcttcgagcgtattcaccgcaccaacctggtaggcatg
ggggtattgccgctggagttcaagccggggaccgaccgcaagaccctgggcctggatggc
agcgaaacctatgacgtgctgggtgcgcgtacgccacgggcgaccctgaccctggtggtt
acccgtgccaatggcgagcgcctggaagtaccggtgacctgccgtctggacaccgccgag
gaagtgtcgatctacgaagcgggcggggtgctgcagcgctttgcccaggacttcctcgaa
gcgaccgcctga

DBGET integrated database retrieval system