KEGG   Pseudomonas putida BIRD-1: PPUBIRD1_3766Help
Entry
PPUBIRD1_3766     CDS       T01975                                 

Definition
(GenBank) Enoyl-CoA hydratase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
ppb  Pseudomonas putida BIRD-1
Pathway
ppb00071  Fatty acid degradation
ppb00280  Valine, leucine and isoleucine degradation
ppb00281  Geraniol degradation
ppb00310  Lysine degradation
ppb00360  Phenylalanine metabolism
ppb00362  Benzoate degradation
ppb00380  Tryptophan metabolism
ppb00410  beta-Alanine metabolism
ppb00627  Aminobenzoate degradation
ppb00640  Propanoate metabolism
ppb00650  Butanoate metabolism
ppb00903  Limonene and pinene degradation
ppb00930  Caprolactam degradation
ppb01100  Metabolic pathways
ppb01110  Biosynthesis of secondary metabolites
ppb01120  Microbial metabolism in diverse environments
ppb01130  Biosynthesis of antibiotics
ppb01212  Fatty acid metabolism
Module
ppb_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:ppb00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    PPUBIRD1_3766
   00650 Butanoate metabolism
    PPUBIRD1_3766
  Lipid metabolism
   00071 Fatty acid degradation
    PPUBIRD1_3766
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    PPUBIRD1_3766
   00310 Lysine degradation
    PPUBIRD1_3766
   00360 Phenylalanine metabolism
    PPUBIRD1_3766
   00380 Tryptophan metabolism
    PPUBIRD1_3766
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    PPUBIRD1_3766
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    PPUBIRD1_3766
   00281 Geraniol degradation
    PPUBIRD1_3766
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    PPUBIRD1_3766
   00627 Aminobenzoate degradation
    PPUBIRD1_3766
   00930 Caprolactam degradation
    PPUBIRD1_3766
Enzymes [BR:ppb01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     PPUBIRD1_3766
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2
Motif
Other DBs
NCBI-ProteinID: ADR61355
Position
4217592..4218281
Genome map
AA seq 229 aa AA seqDB search
MSELITYHAEDGIATLTLNNGKVNAISPDVITAFNAALDRATEERAVVIITGQPGILSGG
YDLKVMTRGPQEAISLVTAGSTLARRLLSHPFPVVVACPGNAVAKGAFLLLSADYRIGVE
GPYKVCLNEVQIGMTMHHAGIELARDRLRRSAFHRSVINAEVFDPQGAVDAGFLDKVVPA
EQLQETAMAAARELKKLNMLAHKNTKLKVRKGLLEALDKAIELDQQHMG
NT seq 690 nt NT seq  +upstreamnt  +downstreamnt
atgagcgagctgattacctaccacgccgaagacggcatcgccacccttaccctgaacaac
ggcaaggtcaatgccatctcgccggacgtcatcactgccttcaatgcagcgctggaccgc
gctaccgaggagcgtgcagtagtgatcatcaccgggcagccgggcattctgtcgggcggt
tacgacctcaaggtgatgacccgcggcccccaagaggccatcagcctcgtcaccgccggt
tccaccctcgcccgccggctgctgtcgcacccgttcccggtggtggtggcctgtcccggc
aatgccgtggccaagggcgccttcctgctgctgtcggccgactaccgcattggcgtcgaa
gggccgtacaaggtatgcctgaacgaagtgcagatcggcatgaccatgcaccacgccggc
attgaactggcccgcgaccgcctgcgccgctcggccttccaccgctcggtgatcaatgcc
gaagtgtttgacccgcagggtgccgtggatgccggcttcctcgacaaggtggtgccggcc
gagcagttgcaggaaacggcaatggccgcagcgcgggagctgaagaagctgaacatgctg
gcgcacaagaacaccaagctgaaagtgcgcaaagggctgctggaggcgctggacaaggca
atcgagctggatcagcagcatatgggctag

DBGET integrated database retrieval system