KEGG   Pseudomonas putida BIRD-1: PPUBIRD1_4567Help
Entry
PPUBIRD1_4567     CDS       T01975                                 

Gene name
hemL
Definition
(GenBank) HemL
  KO
K01845  glutamate-1-semialdehyde 2,1-aminomutase [EC:5.4.3.8]
Organism
ppb  Pseudomonas putida BIRD-1
Pathway
ppb00860  Porphyrin and chlorophyll metabolism
ppb01100  Metabolic pathways
ppb01110  Biosynthesis of secondary metabolites
ppb01120  Microbial metabolism in diverse environments
Module
ppb_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:ppb00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    PPUBIRD1_4567 (hemL)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:ppb01007]
    PPUBIRD1_4567 (hemL)
Enzymes [BR:ppb01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.3  Transferring amino groups
    5.4.3.8  glutamate-1-semialdehyde 2,1-aminomutase
     PPUBIRD1_4567 (hemL)
Amino acid related enzymes [BR:ppb01007]
 Aminotransferase (transaminase)
  Class III
   PPUBIRD1_4567 (hemL)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: ADR62130
Position
5110183..5111466
Genome map
AA seq 427 aa AA seqDB search
MSRSEALFAQAQKHIPGGVNSPVRAFKSVGGTPLFFKHAEGAYVVDEDDKRYVDYVGSWG
PMILGHGHPDVLDSVRKQLEHGLSYGAPTAMETEMADLVCSIVPSMEMVRMVSSGTEATM
SAIRLARGYTGRDAIIKFEGCYHGHSDSLLVKAGSGLLTQGVPSSAGVPADFAKHTLTLP
FNDIAAVEKTLAEVGQTVACIIVEPVAGNMNCVPPAPGFLEGLREQCDKHGVVLIFDEVM
TGFRVSLGGAQGHYGIKPDLSTFGKIVGGGMPVGCFGGKREIMGCIAPLGPVYQAGTLSG
NPLAMAAGLTTLKLISRPGFHAELTDYTSRMLDGLQQRADAAGVPFVTTQAGAMFGLYFS
GADDIVTFEDVMASDAERFKRFFHLMLDGGVYLAPSAFEAGFTSIAHGDKELQITLDAAE
KAFAALK
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
atgtcccgttccgaagccctgttcgcccaagcccagaagcacatccctggcggcgtcaac
tcgccggtccgcgctttcaagagcgttggcggcacgccgctgttcttcaagcatgccgaa
ggcgcctatgtcgttgacgaggacgacaaacgctacgtcgactacgtcggctcctggggc
ccgatgatcctcggccacggccacccggacgtgctggactcggtacgcaagcagctggag
cacggcctgtcctacggcgcgcccaccgccatggaaaccgagatggccgacctggtctgc
tcgatcgtaccgtcgatggaaatggtgcgcatggtcagctcgggcactgaagccaccatg
agcgccatccgcctggcccgtggctacactggccgtgacgccatcatcaagttcgaaggc
tgctaccacggccactccgacagcctgctggtaaaagccggctccggcttgctgacccaa
ggcgtgccaagctcggcaggcgtgccagcggacttcgccaagcacaccctgaccctgccg
ttcaacgacatcgccgccgtcgagaagaccctggctgaagttggccagaccgtggcctgc
atcatcgtggagccggtggccggcaacatgaactgcgtaccaccggcaccgggcttcctc
gagggcctgcgcgagcaatgcgacaagcatggcgtggtgctgatcttcgacgaagtgatg
accggtttccgcgtctcgctcggcggcgcccagggccattacggcatcaagccggacctg
tcgaccttcggcaagatcgtcggtggcggcatgccggtcggctgtttcggcggcaagcgt
gaaatcatgggctgcatcgccccgctcggcccggtctaccaggccggcaccctgtcgggc
aatccgctggccatggccgctggcctgaccaccctcaagctgatcagccgcccaggcttc
cacgccgagctgaccgactacaccagccgcatgcttgacggcctgcagcaacgcgccgac
gccgctggtgtgccattcgtcaccacccaggccggtgccatgttcggcctgtacttcagc
ggcgccgacgatatcgtcaccttcgaagacgtgatggccagcgatgccgagcgcttcaag
cgcttcttccacctgatgctcgacggtggcgtgtacctggcaccgagcgcattcgaagcg
ggcttcacctccatcgcccatggcgacaaggagctgcagatcaccttggatgcggctgag
aaagcctttgctgccctgaagtga

DBGET integrated database retrieval system