KEGG   Pseudomonas putida BIRD-1: PPUBIRD1_4762Help
Entry
PPUBIRD1_4762     CDS       T01975                                 

Definition
(GenBank) 5,10-methylenetetrahydrofolate reductase
  KO
K00297  methylenetetrahydrofolate reductase (NADPH) [EC:1.5.1.20]
Organism
ppb  Pseudomonas putida BIRD-1
Pathway
ppb00670  One carbon pool by folate
ppb01100  Metabolic pathways
ppb01120  Microbial metabolism in diverse environments
ppb01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:ppb00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    PPUBIRD1_4762
Enzymes [BR:ppb01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.20  methylenetetrahydrofolate reductase [NAD(P)H]
     PPUBIRD1_4762
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MTHFR
Motif
Other DBs
NCBI-ProteinID: ADR62319
Position
5319036..5319881
Genome map
AA seq 281 aa AA seqDB search
MSQERRYSFEFFPTKTDAGHEKLMGVARQLATYNPDFFSCTYGAGGSTRDRTLNTVLQLE
SEVKIPAAPHLSCVGDTKAELRSLLAEYKAAGIKRIVALRGDLPSGMGMASGELRYASDL
VEFIRQETADHFHLEVAAYPEMHPQARNFEADLANFVHKVKAGADSAITQYFFNADSYFY
FVERAQKLGVDIPVVPGIMPITNYSKLARFSDACGAEIPRWIRKQLEAYADDTASIQAFG
EEVITHMCEQLLQGGAPGLHFYTLNQAEPSLAIWNNLKLPR
NT seq 846 nt NT seq  +upstreamnt  +downstreamnt
atgtcacaagaacgccgctacagtttcgagttcttcccgaccaagaccgatgccggtcac
gaaaagctgatgggcgtcgcccgccagctggccacctataacccggacttcttctcctgc
acctacggtgccggtggctcgacccgcgaccgcacgctcaataccgtgctgcagctggaa
agcgaagtgaagatacctgccgcgccgcacctgtcgtgcgtgggcgacaccaaggccgaa
ttgcgctccctgctggccgagtacaaggccgccggcatcaaacgcattgtcgctttgcgt
ggtgacctgccgtcgggcatgggcatggccagtggtgaactgcgctatgccagtgacctg
gtcgagttcatccgccaggaaaccgctgatcacttccacctggaagtggctgcctacccg
gaaatgcacccgcaggcgcgcaacttcgaggcggatctggccaactttgtgcacaaggtc
aaggccggtgccgacagcgccatcacccagtacttcttcaacgccgacagctacttctac
ttcgtcgagcgtgcacagaagctgggcgtagacattccggtggtaccgggcatcatgccg
atcaccaactacagcaagctggcccgcttctccgatgcctgtggcgccgagatcccgcgc
tggatccgcaagcagctggaagcctatgccgacgacactgccagcatccaggccttcggc
gaagaagtgattacccacatgtgcgaacagctgttgcaaggcggcgcgccggggctccac
ttctataccttgaaccaggccgaaccgagcctggcgatctggaacaacctgaagctgccg
cgctga

DBGET integrated database retrieval system