KEGG   Pseudopropionibacterium propionicum: HMPREF9154_0895
Entry
HMPREF9154_0895   CDS       T02180                                 

Definition
(GenBank) hypothetical protein
  KO
K17899  D-ornithine 4,5-aminomutase subunit alpha [EC:5.4.3.5]
Organism
ppc  Pseudopropionibacterium propionicum
Pathway
ppc00472  D-Arginine and D-ornithine metabolism
ppc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ppc00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00472 D-Arginine and D-ornithine metabolism
    HMPREF9154_0895
Enzymes [BR:ppc01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.3  Transferring amino groups
    5.4.3.5  D-ornithine 4,5-aminomutase
     HMPREF9154_0895
SSDB
Motif
Pfam: OAM_alpha Lys-AminoMut_A DUF919 DUF2067
Other DBs
NCBI-ProteinID: AFN46524
UniProt: I6X4G3
Position
965427..965798
AA seq 123 aa
MMNTEEQERIDRFEKLRSELADLDDEALKARFWELCHQVMEPVVELARTHTTPSIERSVL
LRMGIDSVTTHAVVENVLNAGLLGKGAGHVVLRLSGRDGIDIRAAAAAIADDPAVMAGLF
EEK
NT seq 372 nt   +upstreamnt  +downstreamnt
atgatgaacaccgaggaacaggagcggatcgaccgcttcgagaagttgcgttccgaactg
gcggacctggacgacgaggccctcaaggccaggttctgggagctgtgccaccaggtgatg
gagccggtggtggagctggcgcgcacccacaccacgccgtcgatcgaacggtcggtgctg
ctgcgcatgggcatcgactcggtcaccacgcacgccgtggtcgagaacgtgctgaacgcc
gggctgctgggcaagggagcggggcacgtggtgttgcgcctgtccgggcgcgacggaatt
gacatccgggcggccgcagccgccatcgccgacgatccggccgtgatggccgggctcttc
gaggagaagtga

DBGET integrated database retrieval system