KEGG   Pseudopropionibacterium propionicum: HMPREF9154_0896
Entry
HMPREF9154_0896   CDS       T02180                                 

Definition
(GenBank) B12 binding domain protein
  KO
K17898  D-ornithine 4,5-aminomutase subunit beta [EC:5.4.3.5]
Organism
ppc  Pseudopropionibacterium propionicum
Pathway
ppc00472  D-Arginine and D-ornithine metabolism
ppc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ppc00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00472 D-Arginine and D-ornithine metabolism
    HMPREF9154_0896
Enzymes [BR:ppc01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.3  Transferring amino groups
    5.4.3.5  D-ornithine 4,5-aminomutase
     HMPREF9154_0896
SSDB
Motif
Pfam: Lys-AminoMut_A OAM_dimer B12-binding
Other DBs
NCBI-ProteinID: AFN45754
UniProt: I6X2B7
Position
965801..968014
AA seq 737 aa
MTDKLDPNTKINVEEILEDLENYHPPRKGWTWRTVPEGGVDMAGFHFRNMSEPLKNSVPM
PTAKYFEGIDPQPAPVVTSEIASGHFEDDIRRMRMAAWNGADHIMVIRTTGQSHIDGLME
GTPEGIGGVPITRKQLRASRKACDLIEDEVGRPINFHSYVSGVAGPEVAVLFAEEGVNGA
HQDPQYNVLYRNINAYRSYVDAGEAKKVMTGARIFQIDGAHNANATARQGWKVMPELMVQ
HGLNSAFSVMVGMPKDLIGLSTVPPSAPPTPKLWFDLPYAVALRDFFSEYKMRAQQNTRY
IESDINEAIRLHVIDTMISMLTSADIQSTITPDEGRNLPWHYNSVRGVQTVKQTWAALDG
IKELLTLNREGPLGGMVRDLKERAIGFLTEMLHAGGYFAAVEQGFFVDSAEFPERNHDGI
ARDGDGGISVGTVIERDPDYLAPVCDHFGNNNLPAGVDKACDLVGGCTLCDPEKIVYIDE
LDPEDSAHKRLERTREYRSGNLLRPEAEWAGDGVALVELMIPERAEIAVEAALEMAKRMG
LSDPEVVNLQVLQPAEGCFVEVKGHVGFDVDKTELTIPEKIELLPEEELRQFVTDHEITV
VAGTVGEDEHSVGMREILDIKHGGLEKYGVKYHYLGTSVPVEKMVDAAIESGSDAILIST
VISHNEVHRTMMKKLAELTKERGIRDEKVLIAGGTQVSRDMAAETGLDATFGRGTKGIDV
LDAIVRTMRGREQEKVG
NT seq 2214 nt   +upstreamnt  +downstreamnt
gtgaccgacaagctggacccgaacaccaagatcaacgtggaggagatcctcgaagatctg
gagaactaccacccgccgcgcaagggctggacctggcgcaccgtgcctgagggtggtgtc
gacatggcgggattccatttcaggaacatgtcggaaccgctgaagaacagcgtcccgatg
cccaccgcgaagtacttcgagggcatcgacccgcagccggccccggtggttacctccgag
atcgcctccgggcacttcgaggacgacatccgccgcatgcggatggcggcctggaacggc
gccgaccacatcatggtgatccgcaccaccgggcagagccacatcgacggcctgatggag
ggaacccccgagggtatcggtggtgtgccgatcacccgcaagcagctgcgcgccagccgc
aaggcctgcgacctgatcgaggacgaggtcggccgcccgatcaacttccacagctacgtc
tccggcgtggcgggccccgaggtcgcggtgctgttcgcggaggagggcgtcaacggcgcc
caccaggacccgcagtacaacgtgctctaccgcaacatcaacgcctaccgcagctacgtc
gacgcgggtgaggccaagaaggtcatgaccggggcccggatcttccagatcgacggcgcc
cacaacgccaacgccaccgcccgccagggctggaaggtgatgcccgagctcatggtccag
cacggcctgaactctgccttctccgtcatggtcgggatgcccaaggacctcatcgggctc
tcgacggtgccgccgagcgccccgccgaccccgaagctgtggttcgacctgccctacgcg
gtcgcgctgcgcgacttcttctccgaatacaagatgcgcgcccagcagaacacccgctac
atcgagtccgacatcaacgaggcgatccgcctgcacgtgatcgacacgatgatctccatg
ctcaccagcgcagacatccagagcaccatcacccccgacgagggacgcaacctgccctgg
cactacaactcggtgcgtggcgtgcagaccgtcaaacagacctgggcggccttggacggc
atcaaggaactgctcaccctcaatcgggaaggcccgctgggcgggatggtgcgcgacctc
aaggaacgcgcgatcggcttcctcaccgagatgctgcacgcgggcggctacttcgcggcc
gtggagcagggcttcttcgtcgactccgccgagttcccggaacgcaaccacgacggcatc
gcccgtgacggggacggcggcatctcggtgggcaccgtgatcgaacgcgatcccgactat
ctggcgccggtgtgtgaccacttcggcaacaacaacctgcccgccggggtggacaaggcc
tgcgacctggtcggcggttgcaccctctgcgatccggagaagatcgtctacatcgacgaa
ctcgacccggaggacagcgcccacaaacggctcgaacggacccgcgagtaccgctctggg
aacctgctgcggcccgaggccgaatgggccggtgacggtgtggccctggtggaactgatg
atccccgaacgggccgagatcgccgtcgaggcggccctcgagatggccaagcgcatgggg
ctgagcgaccccgaggtcgtcaacctccaggtgctgcagcccgccgagggatgtttcgtc
gaggtgaaggggcacgtcggtttcgacgtcgacaagaccgagctgaccatccccgagaag
atcgagctgctccccgaggaggaactgcgccagttcgtcaccgaccacgagatcaccgtc
gtggccggcaccgtcggtgaggacgagcacagcgtcggcatgcgcgagatcctcgacatc
aaacacggcggtctcgagaagtacggcgtgaagtaccactacctcgggacctcggttccc
gtcgagaagatggtggatgcggccatcgagtcgggctcggacgcgatcctgatctccacg
gtcatcagccacaacgaggttcaccgcacgatgatgaagaaactcgccgagctgaccaag
gaacgcggcatccgcgacgagaaggtgctgatcgccggcggtacgcaggtaagccgcgac
atggccgccgagaccggcctggacgccaccttcggccgcggcaccaagggcatcgatgtg
ctcgacgcgatcgtgcgcaccatgcgcggccgcgaacaggaaaaggtcgggtga

DBGET integrated database retrieval system