KEGG   Pseudopropionibacterium propionicum: HMPREF9154_0955Help
Entry
HMPREF9154_0955   CDS       T02180                                 

Definition
(GenBank) putative mannose-1-phosphate guanylyltransferase 1
  KO
K00971  mannose-1-phosphate guanylyltransferase [EC:2.7.7.13]
Organism
ppc  Pseudopropionibacterium propionicum
Pathway
ppc00051  Fructose and mannose metabolism
ppc00520  Amino sugar and nucleotide sugar metabolism
ppc01100  Metabolic pathways
ppc01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ppc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    HMPREF9154_0955
   00520 Amino sugar and nucleotide sugar metabolism
    HMPREF9154_0955
Enzymes [BR:ppc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.13  mannose-1-phosphate guanylyltransferase
     HMPREF9154_0955
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 gp12-short_mid
Motif
Other DBs
NCBI-ProteinID: AFN45036
UniProt: I6WPJ9
Position
1039428..1040507
Genome map
AA seq 359 aa AA seqDB search
MRYVVIMAGGSGTRLWPLSRQGTPKQLLELFDGRSLLRLAYERVAGMIPDARILVCTSRA
YVDVVARQLPELPEENLLGEPVGRDSLSAVAWSAAVLERRDPEAVVAMLSADHIITPVEG
FRTTLERAFDVAETRPRALVTMGVVPTEPHTGFGYLHRDGCVDEELDAWRVSEFKEKPEL
RVAEHYLASGEYWWNAGMFVWRVETLLDQLEALVPDTAKKVRIIAAHNELLDELFPTLLK
TSIDYAVMQPVSLGEGSAEVLAVGLDVSWADVGSYQNLAEQFLLDEHGNRVEGCSMNLDS
SGCVIINTAGERHVVATMGLRDALVVHTPEATLVTPLSEAGRIRELVELVRDRIGAEYA
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
atgcgctacgtggtgataatggcgggcggttcgggcacgaggttgtggcctttgtcgaga
cagggaacgcccaaacagcttctggaactctttgacggacggagcctgctgcggctcgcc
tacgaacgggtggcgggcatgatccctgatgcccggatcctcgtgtgcacatcccgtgcc
tacgtggacgtcgtcgcccggcagcttcccgagctgccggaggagaacctgctcggagaa
cccgtcggacgagattcgctgagcgccgtggcatggtccgccgcggtcctcgaacgacgc
gacccggaggccgtcgtcgccatgctcagcgccgatcacatcatcacccccgtcgaggga
ttccgcaccaccctggaacgcgccttcgacgtggcggagaccaggccccgggccctcgtg
acgatgggggtcgtcccaaccgagcctcacacgggattcggatacctgcaccgggacggg
tgcgtggacgaggaactggacgcctggcgggtctcggagttcaaggaaaaaccggaactc
cgggtggccgagcactacctggcctccggggagtactggtggaacgcggggatgttcgtg
tggcgcgtggagacgctgctggaccaacttgaggcgctggttccggacactgccaaaaaa
gtgcgcataattgctgctcacaacgagctgttggatgagcttttccccaccctcctgaag
acctccatcgactatgcggtcatgcagccggtttccctcggtgagggtagtgcggaggta
cttgcggtggggctggacgtctcctgggccgacgtcggcagctaccagaacctcgccgag
cagttcctgctggacgagcacggaaaccgggtcgaagggtgcagcatgaacctggactcc
tcggggtgcgtgatcatcaacaccgctggtgagaggcatgttgtggcgaccatggggttg
cgggacgcgctcgtggtccacaccccggaggcgaccctcgtgaccccgctgtcggaggcc
ggacggatacgtgaactggtggagttggtgcgcgaccggattggcgccgaatacgcctga

DBGET integrated database retrieval system