KEGG   Pseudopropionibacterium propionicum: HMPREF9154_1800Help
Entry
HMPREF9154_1800   CDS       T02180                                 

Definition
(GenBank) Thi4 domain protein
  KO
K00231  protoporphyrinogen/coproporphyrinogen III oxidase [EC:1.3.3.4 1.3.3.15]
Organism
ppc  Pseudopropionibacterium propionicum
Pathway
ppc00860  Porphyrin and chlorophyll metabolism
ppc01100  Metabolic pathways
ppc01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ppc00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    HMPREF9154_1800
Enzymes [BR:ppc01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     HMPREF9154_1800
    1.3.3.15  coproporphyrinogen III oxidase (coproporphyrin-forming)
     HMPREF9154_1800
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amino_oxidase NAD_binding_8 DAO Pyr_redox_2 HI0933_like FAD_oxidored FAD_binding_2 Pyr_redox Thi4 FAD_binding_3 GIDA Lycopene_cycl AlaDh_PNT_C Pyr_redox_3 ApbA NAD_binding_9 3HCDH_N NAD_binding_7 FMO-like MCRA
Motif
Other DBs
NCBI-ProteinID: AFN46611
UniProt: I6WTU2
Position
complement(1947736..1948986)
Genome map
AA seq 416 aa AA seqDB search
MRAVIVGAGVAGLAAAHRLARAGAEVVVLEASERIGGMVAPLTIAGKVIDGGAEAYARRL
GVADELCATLGLEVAAPTGGPHIRWSATRSWPGADGVLGIPAGPDDPALTSALDGTDLAT
ALAEPGLGDEIGAGAATVGELVTARLGRAVTDRLVAPVTRTVYRMEPDQMSLAQFAPGLR
GPGSLYAKVAAARGSRSAVAQPIGGLIRLVEALASDIRGNGGKIRLGARVTGIGRDATVT
VGEDRLEADCVILACPARPAAELLGGLGITASPPATGTSLNAVLALEPEPLAGAPVGSGV
MLGQPIPGLAARALTHYSAKWPWSRGEVELIRLNYAPDANPTREQALADARLLLGCENLV
LRDHALVRWPAVPRALPAAERARLLDSLPTNVKVAGAWVAGNGIEAAIASGLEAAV
NT seq 1251 nt NT seq  +upstreamnt  +downstreamnt
gtgagggccgtgatcgtcggggccggggtggccgggctggcggccgcccaccggctggcc
cgcgcgggcgccgaggttgtcgtcctggaggcctcggaacggataggcgggatggtggcg
ccgctgacgatagccgggaaggtgatcgacggcggggccgaggcctacgcccgccgcctg
ggagtcgcggacgaactgtgcgcgaccctcgggctggaggtcgccgcccccacgggggga
ccgcacatccgctggtccgccacgcggtcctggcccggcgccgacggagtactgggcatt
cccgccggcccggacgatccggccctgacttccgccctggacggcacggacctggcaacg
gcactggccgaacccggactcggcgacgagatcggggccggcgcagccaccgtcggcgaa
ctggtgaccgcgcgcctcggccgggccgtaaccgaccggctggtggcccccgtgacccgg
accgtctaccggatggaacccgaccagatgtcgctggcgcagttcgcgcccggccttagg
ggacccggatccctgtacgcgaaggtagcggcggcccgcggtagccgctccgccgtcgcc
caacccatcgggggtttgatccgcctcgtcgaggccctggcctccgacatccggggcaac
ggcggaaagatccggctcggtgcccgtgtcaccgggatcggacgcgacgcgacggtcacc
gtcggcgaagaccggctagaggcagactgcgtgatcctggcctgccccgcccgtcccgcc
gcggagctgctcggcgggctgggaatcaccgcatcgccacccgcgacggggacctcgctc
aacgcggtcctggcgctggaacccgagccgctggctggagcgccggttggttccggggtg
atgctcggccagccgatcccggggcttgcagcccgggcgctgacccactactcggcgaaa
tggccctggagccgcggcgaggtggagctgatccgcctcaactacgcgcccgacgccaac
cccacccgggagcaggccctggccgatgcccgcctgctgctcgggtgcgagaacctggta
ctccgtgaccacgccctggtgcgctggcccgccgtgcccagggcgctcccggctgcggaa
cgggcaaggttgctggattccctccccaccaacgtcaaggtggcgggagcctgggtggct
ggcaatgggatagaagccgcaatcgcatctggactggaggcggcagtatga

DBGET integrated database retrieval system