KEGG   Pseudopropionibacterium propionicum: HMPREF9154_3069Help
Entry
HMPREF9154_3069   CDS       T02180                                 

Gene name
dltC
Definition
(GenBank) D-alanine--poly(phosphoribitol) ligase, subunit 2
  KO
K14188  D-alanine--poly(phosphoribitol) ligase subunit 2 [EC:6.1.1.13]
Organism
ppc  Pseudopropionibacterium propionicum
Pathway
ppc00473  D-Alanine metabolism
ppc01100  Metabolic pathways
ppc01503  Cationic antimicrobial peptide (CAMP) resistance
ppc02020  Two-component system
Brite
KEGG Orthology (KO) [BR:ppc00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    HMPREF9154_3069 (dltC)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    HMPREF9154_3069 (dltC)
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01503 Cationic antimicrobial peptide (CAMP) resistance
    HMPREF9154_3069 (dltC)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   01504 Antimicrobial resistance genes [BR:ppc01504]
    HMPREF9154_3069 (dltC)
Enzymes [BR:ppc01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.13  D-alanine---poly(phosphoribitol) ligase
     HMPREF9154_3069 (dltC)
Antimicrobial resistance genes [BR:ppc01504]
 Gene sets
  CAMP resistance modules
   Cationic antimicrobial peptide (CAMP) resistance, dltABCD operon [MD:M00725]
    HMPREF9154_3069 (dltC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PP-binding
Motif
Other DBs
NCBI-ProteinID: AFN44998
UniProt: I6XLS2
Position
3327972..3328211
Genome map
AA seq 79 aa AA seqDB search
MTEVEEKVSALIVQVCDTDEVLSDPDLDLFEAGLIDSMGFVELLFGLEQEFGIQVPPTEI
ERDDVSTVTKILAFVNEKL
NT seq 240 nt NT seq  +upstreamnt  +downstreamnt
atgacggaagttgaagagaaggtctccgccctgatcgtccaggtctgcgacactgatgag
gtgctgtcggatccggacctcgacctgttcgaggccggcctgatcgattcaatgggcttc
gtcgaactgctgttcggcctggagcaggagttcggcatccaggtgccacccaccgagatc
gagcgcgacgacgtctcgacggtcaccaagatcttggcgttcgtcaacgagaaactgtga

DBGET integrated database retrieval system