KEGG   Pelobacter propionicus: Ppro_0028Help
Entry
Ppro_0028         CDS       T00436                                 

Definition
(GenBank) nucleotidyltransferase
  KO
K16881  mannose-1-phosphate guanylyltransferase / phosphomannomutase [EC:2.7.7.13 5.4.2.8]
Organism
ppd  Pelobacter propionicus
Pathway
ppd00051  Fructose and mannose metabolism
ppd00520  Amino sugar and nucleotide sugar metabolism
ppd01100  Metabolic pathways
ppd01110  Biosynthesis of secondary metabolites
ppd01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:ppd00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    Ppro_0028
   00520 Amino sugar and nucleotide sugar metabolism
    Ppro_0028
Enzymes [BR:ppd01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.13  mannose-1-phosphate guanylyltransferase
     Ppro_0028
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.8  phosphomannomutase
     Ppro_0028
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase PGM_PMM_II PGM_PMM_I Hexapep NTP_transf_3 DUF4954 PGM_PMM_III IspD
Motif
Other DBs
NCBI-ProteinID: ABK97668
UniProt: A1AJZ8
Position
complement(31489..33996)
Genome map
AA seq 835 aa AA seqDB search
MKAVIMAGGFGTRIQPLTSNLPKPMIPLFNRPIMLHIVELLKKHDITDLVMLLYHQPEVI
KKFFRDGSDFGVKITYVIPLQDMGTAGAVKAAEKYLDERFLVISGDLLTDFNLKKVVNFH
NDNKAMATITLTSVKDPLQFGVVITDKERRITQFLEKPGWGEVISDTINTGIYVLEPEIF
KYIPEGENFDFSQDLFPTLLANNDPLFGFPARGYWRDIGNTDSYREAYHDIFRGKVNLKI
YEPKLDFVGKDLRIASDVTLGDPSGLEGTVVVGDNSQILRGVQIKDSVIGRNCTIEQGVR
LSRCVIWDNTYVKKGARINDCVVCSNVLIGQGASLEEGVIIADGTSIGDETVIRRDVKIW
PRKVVEPGSIVTANLIWGEKWRKLLFEGAIVRGLSNVELTPEFVAKLGCAYGTMLPKGSF
VLGGRDSNRVTRMLKRCFMGGILSTGVNVRDLKMAPQPMLRYKLKTFGEVGGFHFRQAED
DPAALEIVFMDSDGLDFSSGMAKNVERIFFKENFRRAHHTEPGAITDINNVADYYREGFL
RAIDREQLKKAAWTVVIDFNHSAASQILPLILNELGCYVIALNAYVDEGRGFTREMDKQT
ALEQLSKIVSSVGAQAGFWLDPTAEAITLLDETGHILSGIELLSLFASLTMKSGQRGVIA
VPVQAPSSIEQMAAPKRCQITRTKSSERAMLEAAGSSEVILAGSTDGRFALPVFQASFDG
MFAIARLIELAAASGGPLSRSLADLPECAYLQTSISCPWEMKGGIMRKMSEDSLDKEATF
IDGIKVHFGDEWILLLPDQHSHYIHIVAEGKDHKSAQRLLAEYQKKVESWKKELE
NT seq 2508 nt NT seq  +upstreamnt  +downstreamnt
atgaaagccgtcatcatggccggcggattcggcacccgcatccagccgctcaccagcaac
ctccccaagccgatgattcccctgttcaaccgtccgatcatgctccatatcgtggagctg
ctcaaaaaacatgacataaccgatctggtcatgctgctctaccatcagcccgaggtgatc
aagaagttcttccgggacggctccgatttcggggtcaagatcacctacgtgataccgctg
caggacatgggcacggccggggcggtcaaggcggccgagaagtacctggacgaacgcttc
ctggtgatcagcggcgacctgctaaccgacttcaacctgaaaaaggtcgtcaacttccac
aacgacaacaaggccatggccaccatcaccctgacttcggtcaaggacccgctccagttc
ggggtggtgatcaccgacaaggagcggcgcatcacccagttcctggaaaagccgggctgg
ggcgaggttatctccgacaccatcaataccggcatctacgtcctggagccggagatattc
aagtacattcccgagggagaaaacttcgacttctcccaggatctcttccccaccttgctg
gcgaacaacgacccgctgttcggcttcccagccagggggtactggcgggacatcggcaac
accgattcctaccgcgaggcctaccacgacatcttcaggggcaaggtcaacctgaagatc
tacgagcccaagctggacttcgtgggcaaggatctgcgcatcgccagcgacgtgaccctg
ggcgacccgtcggggctggagggaacggtggtcgtgggtgacaacagccagatcctgcgc
ggcgtgcagataaaggactcggtcatcggacgcaactgcaccatcgagcagggggtcaga
ctgagccgctgcgtgatctgggacaacacctatgtcaagaagggggcgcgcatcaacgac
tgcgtggtctgctccaacgtgctcatcggccagggagcaagcctggaagagggggtcatc
attgccgacggaacctccatcggcgacgagacggtgatcaggcgggatgtgaagatctgg
ccacgcaaggtggttgagccgggatccattgtcaccgccaacctgatctggggcgaaaaa
tggcgcaagctgctcttcgaaggggccatcgtcagggggctctccaacgtggagttgacc
ccggaattcgtggccaagctgggctgcgcctacggcaccatgctccccaaggggagtttc
gtgcttggtggccgcgattccaaccgggtcacgcgcatgctcaagcgctgcttcatgggc
ggcatcctctccaccggggtcaacgtgcgcgacctgaagatggcgccccagcccatgctg
cgctacaagctgaagaccttcggcgaggtggggggattccacttccgccaggcagaggac
gacccggcagccctggagatcgtgttcatggacagcgacgggctggacttctccagcggc
atggccaagaacgtggagcgcatcttcttcaaggaaaacttccgccgcgcccaccacacc
gagccgggcgccatcacggacatcaacaacgtggccgactactaccgcgagggtttcctg
cgtgcgattgaccgggaacagctcaagaaggccgcctggacagtggtgatcgacttcaac
cactccgccgccagccagatcctgccgctgatcctcaacgaactgggttgctacgtcatc
gccctgaacgcctacgtggacgaggggcgcggcttcacgagggagatggacaagcagacc
gctctggagcagctctccaagatcgtctcctccgtgggcgcccaagccggtttctggctc
gaccccaccgcggaagccatcaccctgctggacgaaaccggccacatcctgagcggcatc
gaactcctgtccctgttcgcctcactgaccatgaagagcggccagaggggggtgatcgcc
gtaccggtgcaggccccctcgagcatcgaacagatggctgcccccaagcgctgccagatc
acccgcaccaagagcagcgaacgggccatgctggaggcggccggttccagcgaggtgatc
ctggccggctccaccgacggccgtttcgccctgccggtcttccaggcctccttcgacggc
atgttcgccatcgcccggctgatcgagctggccgcggccagcggcggcccgctctcccga
tcactggccgacctcccggagtgcgcctatctgcagaccagcatctcctgtccctgggag
atgaaggggggcatcatgcgcaagatgagcgaggacagcctggacaaggaggcaaccttc
atcgacgggatcaaggtccatttcggcgacgagtggatcctgctgctgccggaccagcac
agccactacatccatatcgttgccgaggggaaggaccataaatcggcccagaggctgctg
gctgaataccagaaaaaagtggagagctggaagaaagagctggaatag

DBGET integrated database retrieval system