KEGG   Pelobacter propionicus: Ppro_0246
Entry
Ppro_0246         CDS       T00436                                 
Name
(GenBank) type IV secretory protease
  KO
K12062  conjugal transfer pilin signal peptidase TrbI
Organism
ppd  Pelobacter propionicus
Brite
KEGG Orthology (KO) [BR:ppd00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:ppd02044]
    Ppro_0246
Secretion system [BR:ppd02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   Ppro_0246
SSDB
Motif
Pfam: Peptidase_S26
Other DBs
NCBI-ProteinID: ABK97881
UniProt: A1AKL1
Position
complement(243846..244340)
AA seq 164 aa
MPKPLPPDFRNWRLWLAITCLLIAGTLLPGKFCVTLTPSLKHRVYWLTRNPDHVVRGDYV
LFHDEELAARVGMKKSEDVLKLVGCDGGDQLTVDGEKKFYCNGEYLVRAKNFTLKGEPLR
HFAFSGTIPEGAMFVVGEHKDSYDSRYFGFVDKKRILAKAYPIF
NT seq 495 nt   +upstreamnt  +downstreamnt
atgccgaaaccgttgccccctgatttccgcaactggcgcctctggttggcgatcacctgc
ctccttattgcaggaacactgctcccaggcaagttctgtgtcaccctgacgccttccctc
aagcatcgggtctactggctcacccggaatccggaccatgtggttcggggggattacgtt
ctgttccacgatgaggaattggcggccagggtcgggatgaagaaatcggaagacgtgctg
aagctcgtggggtgcgatgggggggaccaactcaccgtggatggggagaagaaattctac
tgcaacggtgagtacctggtcagggccaagaattttaccctcaagggggaaccgctacgc
cacttcgccttcagcggcacgatccccgagggagccatgttcgtcgtgggagagcacaag
gatagctacgattctcggtatttcggctttgtggacaagaaacgcatcctggcgaaagcc
tatccgatcttctga

DBGET integrated database retrieval system