KEGG   Pelobacter propionicus: Ppro_0251
Entry
Ppro_0251         CDS       T00436                                 

Definition
(GenBank) hypothetical protein
  KO
K12058  conjugal transfer mating pair stabilization protein TraN
Organism
ppd  Pelobacter propionicus
Brite
KEGG Orthology (KO) [BR:ppd00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:ppd02044]
    Ppro_0251
Secretion system [BR:ppd02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   Ppro_0251
SSDB
Motif
Pfam: TraN
Other DBs
NCBI-ProteinID: ABK97886
UniProt: A1AKL6
Position
complement(247825..249666)
AA seq 613 aa
MLVRVVCSLCYVTLLLSLSGAHQTALALVSCQDRISANTPHRYIDALALFTEYNGTTYAI
AKSAVSGSQSLPDGYFNFEANISREYLTTGTDTASLKRMLALGRFGEARPVRIDSRQTLD
FVLKRFGAYLGSADSPQSTYIDAWKEFGLTGFTALAGTGLPFTNWGTGTPYGGQDPQAVV
MGRDGIWTSGLDGVRSSQIVQFPGKLDCSYSYIDPTTLPPVSPPATETFGTIICAQDLNN
NGYAADPGEVATCVVTPQGQYCPVGSVECNLVNSAYVCPLGSQYVCMEYQGVMRCSSNSC
FDQTTTEEEADDIDESMLRDDGDRDALGQCLGQLYVFNGKASRCRPPGMKVGMINDCCES
DQVAAEDTGNSILSATQGIQMAYEIGQVAYYGNALLTGAAQISAITTTATGTVASMTVVT
AAGTTTTLSGAVATGAYATMASGATGASAIGAGLQAYATALLNPATIAVAVAVMVVMKLL
MGGGCDQGDIQTAMQNAAKDCHYVGSYCQKKWPLVGCVQKAKSYCCFNSKMARIIHEQGR
PQLLPFQPNGAWGSAKHPNCRGFTPEEFQALDFSRIDLSEYFADVQKDLATKIQGSQQTI
MQNIQNRYQAAPK
NT seq 1842 nt   +upstreamnt  +downstreamnt
atgctcgtccgtgtcgtctgttcactatgttatgtcacgcttctgctctcgctctcgggt
gcccaccagacggcgctggctcttgtcagttgccaggacaggatttcggcaaatacgccg
catcgttacatcgatgctctggcactgttcaccgagtacaacggcacaacctatgccatc
gccaaatcggccgtgagcggcagccagtcgctgccggacggctatttcaatttcgaggcg
aacatcagccgggaatacctgacgaccggaaccgatacggcatcactcaaacggatgctc
gcccttggtcgattcggtgaggccaggccggtcaggatcgacagtcggcagacgctggat
ttcgttctcaaacgtttcggagcctatctcggttcggcggattccccacaaagcacctac
atcgacgcttggaaggagttcggcctgaccggttttaccgcccttgccggtacgggactt
cctttcaccaactggggcacgggaacaccctatgggggacaggatccgcaagcggtagtc
atgggacgtgacgggatctggaccagcggcctggatggggtcaggtcgtcccagatcgta
cagtttcccggcaaactggactgttcgtattcctacatcgatccgacgacgctaccgccg
gtatcgccacccgctaccgagacgttcggcaccatcatctgcgcccaggacctgaacaac
aatggctatgccgccgatccgggcgaggtggccacctgtgttgtgacgccacaggggcag
tactgtccggtgggttccgtcgagtgcaatctggtcaactcggcatacgtctgcccgctg
ggctcccagtacgtttgcatggaataccagggtgtgatgcgttgctcgtcgaattcctgc
ttcgatcaaacaacgactgaggaggaggcagatgacatcgatgaatcgatgctgcgggac
gacggggatcgggatgccctggggcagtgtctcgggcagttgtacgtcttcaacggcaag
gcgtcccgctgtcgcccgccggggatgaaggtggggatgatcaacgattgctgcgagagc
gaccaggtggctgcggaagacaccggtaacagtatcctgtcggcgacgcaggggattcag
atggcatacgagatcggtcaggtcgcctactacggcaatgccctgctgaccggcgccgcc
cagatttcggccatcaccacgaccgcaaccggcacggtcgcgtccatgaccgtggtcacc
gcggccggaaccaccacgaccctgtcgggagcggtggcaaccggagcctacgccaccatg
gccagcggcgctacgggagcctcggccatcggcgcaggcctgcaggcctatgccacggcg
ctgttaaatccggcaaccattgccgttgccgtggctgtcatggtggtgatgaagctgttg
atggggggaggctgtgatcagggagatattcagacggcgatgcagaatgccgccaaggat
tgccactatgtgggcagttactgtcagaagaaatggccgctggtggggtgtgtccagaag
gccaagagctactgctgtttcaactcgaaaatggcaaggattatccatgagcagggaaga
ccacaactcctgccgttccagccgaacggcgcctgggggagcgcgaaacacccgaactgc
agaggattcacgcccgaagaatttcaggcactggatttctcgcggatcgatctttctgaa
tatttcgcggacgtgcagaaggatctggccaccaagatccagggatcgcagcaaacgatc
atgcagaacatccagaacagatatcaggcggcgccaaaatga

DBGET integrated database retrieval system