KEGG   Pelobacter propionicus: Ppro_0255
Entry
Ppro_0255         CDS       T00436                                 

Definition
(GenBank) TraB pilus assembly family protein
  KO
K12065  conjugal transfer pilus assembly protein TraB
Organism
ppd  Pelobacter propionicus
Brite
KEGG Orthology (KO) [BR:ppd00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:ppd02044]
    Ppro_0255
Secretion system [BR:ppd02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   Ppro_0255
SSDB
Motif
Pfam: TrbI
Other DBs
NCBI-ProteinID: ABK97890
UniProt: A1AKM0
Position
complement(254549..255805)
AA seq 418 aa
MMKDKLLAYWNGLGGGKRKNLVWCLTGSILVFVFAVGYFAMSGGKDPAISISPKQVPLNI
EPKLLEKSQFLESQKEIAKRDDKVAELQKKLDEITREKRGEVPSAPAAPDSLPSVTGQPQ
GQTQKAGSGRAALSKQSLPPPPPVPQGSTILLPPPPAASQGIQAGQMPDPAETELGNISI
VSSPVSSKSAKHDAEDKKKDAGTVSVYLPPSFMEATLLSGLDAPTTSEAKGNPVPVLLRV
KTPAVLPNSVKANLKGCFVIADGKGNLATERAELLLVSLSCLDRKGQAVVDQKVKGFVVD
ADGKIGLRGRVVAKMGSMIARSMLAGFFGGAGDAIKASATTMSVSPLGTTQTVDPKDIAM
AGAGTGLSSGFKEIQKFYMELAKQTMPVIEVGATKPVTLVISEGINLQIKRIAKGGSE
NT seq 1257 nt   +upstreamnt  +downstreamnt
atgatgaaagataagcttctggcgtactggaacggacttggtggcggcaaacgtaaaaat
ctcgtctggtgccttaccggcagcattctcgtttttgtattcgctgttggctactttgcc
atgagcggggggaaagatcccgccatatcaataagcccgaagcaggtccccctgaacatc
gaaccgaagctcctggaaaaatcccagtttcttgagagccagaaagagatagccaaacgg
gacgacaaagttgccgaactccagaaaaaactcgatgaaattacccgcgaaaaaaggggg
gaagtgccgtctgctccggcagcgcctgattctcttccctccgtcaccggacaaccgcag
ggccagactcagaaggccggttccggcagagcggcactatcaaagcagtcgctgccgcct
cctccacccgtgccacaaggcagtacaattttgctgcctccaccacctgctgcgtcgcag
ggtattcaggcagggcagatgccggatccagccgagacggaacttggcaatatctccata
gtctcgtctcccgtttccagtaaatccgccaagcatgacgcggaagataaaaaaaaagac
gccggaacggtctccgtctatctgcccccttcctttatggaggcgaccctgttgagtggc
ttggacgcccccaccacttcggaagccaaaggtaatccggtgccggtcctgctcagggtc
aagactccggcggtcctgcccaacagcgtcaaggccaacctcaagggatgcttcgtcatc
gctgacggcaaggggaacctggccaccgaacgagccgaactgctgctggtctccctgtca
tgcctcgaccgcaaggggcaggcggtggttgaccagaaggtcaaagggttcgtcgtggac
gcagacggcaagatcggcctgcgcggtcgggtcgtggccaaaatgggctccatgattgcc
agaagcatgttggccggttttttcggcggcgccggtgatgccatcaaggcgtcggccacc
accatgtcggtaagcccactggggaccacccagacggtagatccaaaggatatcgccatg
gccggtgccggaactggcctgtccagcggcttcaaggagatccagaaattctacatggaa
ctggccaaacagaccatgccggtcatcgaggtaggagccaccaagccggtgacgctggtc
atcagcgaggggatcaacctgcaaatcaaaaggatcgccaagggaggctcggagtga

DBGET integrated database retrieval system