KEGG   Pelobacter propionicus: Ppro_0323Help
Entry
Ppro_0323         CDS       T00436                                 

Definition
(GenBank) pyruvate ferredoxin oxidoreductase, delta subunit
  KO
K00171  pyruvate ferredoxin oxidoreductase delta subunit [EC:1.2.7.1]
Organism
ppd  Pelobacter propionicus
Pathway
ppd00010  Glycolysis / Gluconeogenesis
ppd00020  Citrate cycle (TCA cycle)
ppd00620  Pyruvate metabolism
ppd00640  Propanoate metabolism
ppd00650  Butanoate metabolism
ppd00680  Methane metabolism
ppd01100  Metabolic pathways
ppd01120  Microbial metabolism in diverse environments
ppd01130  Biosynthesis of antibiotics
ppd01200  Carbon metabolism
Module
ppd_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:ppd00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Ppro_0323
   00020 Citrate cycle (TCA cycle)
    Ppro_0323
   00620 Pyruvate metabolism
    Ppro_0323
   00640 Propanoate metabolism
    Ppro_0323
   00650 Butanoate metabolism
    Ppro_0323
  Energy metabolism
   00680 Methane metabolism
    Ppro_0323
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    Ppro_0323
Enzymes [BR:ppd01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     Ppro_0323
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer4_6 Fer4 Fer4_21 Fer4_2 Fer4_7 Fer4_10 Fer4_9 Fer4_17 Fer4_15 Fer4_13 Fer4_4 Fer4_16 Fer4_8
Motif
Other DBs
NCBI-ProteinID: ABK97957
UniProt: A1AKT7
Position
322894..323184
Genome map
AA seq 96 aa AA seqDB search
MTNWRELPPGVVITDPGSSRNFKTGSWRSFKPVWIRENCVHCMLCWVYCPDTSVLTADNG
RGEFDYDFCKGCGICALECPGKKGNKAIVMEEEGAR
NT seq 291 nt NT seq  +upstreamnt  +downstreamnt
atgacgaactggcgggaacttcctcccggggtggtcataaccgatccgggcagctcacga
aacttcaagaccggctcctggcgctcctttaagccggtctggatccgcgagaactgcgtc
cactgcatgctctgctgggtctactgcccggacacgtccgtactgaccgctgacaacggg
cgcggcgaattcgactacgatttctgcaaggggtgcggcatctgcgccctggagtgcccc
ggcaagaaggggaacaaggccattgtcatggaagaggagggggcccgatga

DBGET integrated database retrieval system