KEGG   Pelobacter propionicus: Ppro_0685Help
Entry
Ppro_0685         CDS       T00436                                 

Definition
(GenBank) LSU ribosomal protein L22P
  KO
K02890  large subunit ribosomal protein L22
Organism
ppd  Pelobacter propionicus
Pathway
ppd03010  Ribosome
Brite
KEGG Orthology (KO) [BR:ppd00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    Ppro_0685
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:ppd03011]
    Ppro_0685
Ribosome [BR:ppd03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    Ppro_0685
  Bacteria
    Ppro_0685
  Archaea
    Ppro_0685
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22
Motif
Other DBs
NCBI-ProteinID: ABK98316
UniProt: A1ALU6
Position
725389..725724
Genome map
AA seq 111 aa AA seqDB search
MESSAKLTSVRLSPRKTRLVVDLVRGKVIQEALNTLRFLPQPSAKLVSKLLQSAVANAEQ
KGVSDVDALYVKTIYVDGGSVLKRFLPRAMGRASKIRKPTSHISVTLSDSK
NT seq 336 nt NT seq  +upstreamnt  +downstreamnt
atggaatccagtgctaagctgacatctgttcgcctttcaccgcgtaaaacaagacttgtt
gttgatctcgttagaggtaaggtaatccaggaagcgcttaatactctgcggttccttcct
cagccttcagcgaagcttgtttctaagctgttgcagtctgcggtagcaaatgcggagcaa
aaaggtgtttcagatgttgatgctttatatgtaaagacaatttatgttgatggcggttct
gtgttgaaacggtttttaccgcgtgccatgggacgggccagcaagattcgtaagccgaca
agccatatcagtgttacactgtcagattcgaaatag

DBGET integrated database retrieval system