KEGG   Pelobacter propionicus: Ppro_0724Help
Entry
Ppro_0724         CDS       T00436                                 

Definition
(GenBank) methyl-accepting chemotaxis sensory transducer
  KO
K03406  methyl-accepting chemotaxis protein
Organism
ppd  Pelobacter propionicus
Pathway
ppd02020  Two-component system
ppd02030  Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:ppd00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Ppro_0724
 09140 Cellular Processes
  09142 Cell motility
   02030 Bacterial chemotaxis
    Ppro_0724
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02035 Bacterial motility proteins [BR:ppd02035]
    Ppro_0724
Bacterial motility proteins [BR:ppd02035]
 Flagellar system
  Chemotaxis proteins
   MCPs
    Ppro_0724
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MCPsignal 4HB_MCP_1 TarH HAMP BLOC1_2 DUF5500 TBPIP RuvB_C Ferritin Muted DUF2533
Motif
Other DBs
NCBI-ProteinID: ABK98355
UniProt: A1ALY5
Position
759359..760978
Genome map
AA seq 539 aa AA seqDB search
MSKFSIGTRLLAGFSFVLILLAVIIATGVNSLNKSEDQLKNVKRISGLSNKVVVATIADK
DIQELVKGLIMVDLSAERGRVVASIRELEQKCAEAVDVLDKNTKTPDGKKLVAEVKAARE
EVARVDEKLITLAISGDSAGFKAMMNVEGEKAIARSSSALDALLSFYDKRVGVRVDDAID
NAAYATRLMFGLGIAAILLGILAAVFITRSITVPLHTCVEMADKIADGDMSISMRVEDGK
CETVHLIKAIANMAERIRDAIGRVSLAAGEVSAAVTELHENSQRMVRGTDEVSSQASMVA
TAGEEMAATSLDIANNCNSAAESSRHANQLATSGASIVQGTVDGMARIAERVRATARSVE
NLGSRSDEIGAIVGTIEDIADQTNLLALNAAIEAARAGEQGRGFAVVADEVRALAERTTR
ATKEIGGMIKAIQTETHQAVLSMDEGVNEVERGTQEASKSGSALEEILAQINEVTNQINQ
IATAAEEQSSTSRDISNNMHMITGIVNETAQGTQATAKAADQLTALANDLKVLVAQFRL
NT seq 1620 nt NT seq  +upstreamnt  +downstreamnt
atgagcaaatttagcatcggaacccgtctgctggcaggattttcgtttgttctgatactt
ctggccgttatcatcgccacaggggtcaacagccttaacaagagcgaggatcagctgaag
aatgtcaaacgtatcagcggcctgagcaacaaggtagtggttgcgaccatcgccgacaaa
gatattcaggagttggtgaaggggctgataatggttgacctgagcgctgagagggggcgg
gtcgtcgccagcatacgcgaactggagcagaagtgcgcggaagcggtggatgtgctggac
aaaaacaccaaaacaccggatggcaagaagcttgtggccgaggtgaaggcagcccgtgag
gaagttgccagagtggatgaaaaactcatcaccctggcgatcagtggtgacagtgccggg
tttaaggcgatgatgaatgttgaaggagaaaaggcgattgccaggtcatcatcggcgctt
gacgctctgctgtcgttctacgacaaacgtgtgggagttcgcgtagatgatgcgatcgac
aatgccgcctacgcaacccgactgatgtttggtctgggcatcgcagccatcctcctggga
attctggcagccgttttcatcacgcgcagcattacggtgccattgcacacctgtgtggag
atggccgacaagattgccgatggtgacatgtccatttccatgagagtcgaagacggcaaa
tgcgaaacggtgcatctcatcaaggccatagcaaatatggcagagagaattcgcgatgcc
atcggccgtgtttccctggctgccggcgaggtctccgccgctgttacggaactgcatgaa
aattcgcaacgcatggtacgggggactgatgaggtttcctcccaggcttccatggttgcc
actgccggtgaggaaatggcagccacatctctggatatcgccaacaactgcaactccgca
gccgagagctcgcgccatgccaatcagcttgctaccagcggagcttccattgtccagggg
accgttgacgggatggcccgcatcgccgagcgggtccgtgccacggcgcgcagtgtcgag
aatctcggctcacgctcggacgagatcggcgccattgttggcaccatcgaggatatcgcg
gatcagaccaatctgttggcactcaacgcggcaatcgaggcggcccgcgccggagaacag
gggcggggattcgcggtggtcgccgacgaggttcgcgccctcgccgaacgtacgacccgt
gcgaccaaggagatcggcggtatgatcaaagctatccagaccgagacgcaccaagcggtt
ctttctatggatgagggcgtcaacgaggtggagagaggtacgcaagaagcgtccaagtcc
ggcagtgcactggaggagattcttgcgcagatcaacgaggttaccaaccagatcaaccag
attgccaccgctgcggaagaacagagctcaaccagtcgcgacatcagcaacaacatgcat
atgatcaccggaattgtcaatgaaaccgcacagggaacccaggcaaccgccaaggccgca
gaccagttgacggctcttgccaatgacctgaaggtgcttgttgcccagttcaggctgtag

DBGET integrated database retrieval system