KEGG   Pelobacter propionicus: Ppro_1026Help
Entry
Ppro_1026         CDS       T00436                                 

Definition
(GenBank) catalytic domain of components of various dehydrogenase complexes
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
ppd  Pelobacter propionicus
Pathway
ppd00010  Glycolysis / Gluconeogenesis
ppd00020  Citrate cycle (TCA cycle)
ppd00620  Pyruvate metabolism
ppd01100  Metabolic pathways
ppd01110  Biosynthesis of secondary metabolites
ppd01120  Microbial metabolism in diverse environments
ppd01130  Biosynthesis of antibiotics
ppd01200  Carbon metabolism
Module
ppd_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:ppd00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Ppro_1026
   00020 Citrate cycle (TCA cycle)
    Ppro_1026
   00620 Pyruvate metabolism
    Ppro_1026
Enzymes [BR:ppd01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Ppro_1026
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl EKR
Motif
Other DBs
NCBI-ProteinID: ABK98652
UniProt: A1AMT2
Position
1075772..1077124
Genome map
AA seq 450 aa AA seqDB search
MPKWGLTMEEGTLAKWLIDEGSQIEPGMAIAEVETDKIVNVMEANQSGVLAKQIADEGDV
LPVGALIGVITQGDAAESAIADFIANFGSDEEAAPAEESACSAASDDIYCLTMPKWGLTM
EEGTLVKWLIDEGTQIELGMSIAEVETDKIVNVLEATHAGILRRKIADEGDELPVGALLG
VIADASVSDQAIDAFLAGGATETAAEDASVPAAEEPQAESAAAGQILDGSLPLEGMRAAI
SKTVTTSWTTIPHYMVTVAIDMGRAEALSSAQKQAGKRVSINDMLIKASALAIGKYPLIN
AAFSGKNITLHGDVNVAMAIGLEEGVIMPVIRECQKLPVQQIGERSRELVALAKEGKLGS
AELSGGTFAISNMGMLGVEDFIAIVPPNLSAILAVGMVKDEPVVRDGQVVAARMMRVTVS
ADHRVHDGAYAAKFLGELKGILEAPETILA
NT seq 1353 nt NT seq  +upstreamnt  +downstreamnt
atgcccaaatgggggctgaccatggaagagggcaccctggccaagtggctgatcgacgag
ggaagccagatcgaaccggggatggctattgccgaggtggagaccgacaagatcgtcaac
gtgatggaggcgaaccagagcggtgtcctggccaagcagatagccgatgaaggcgatgtg
ctgccggtgggcgcgctgattggcgttatcacccaaggggatgccgcggaaagtgccatc
gccgattttatcgccaatttcggctctgatgaggaagcagcgccagcggaagagtctgcc
tgcagcgcagcatccgatgacatctactgcctgaccatgcccaagtgggggctgaccatg
gaagaggggaccctggtcaagtggttgatcgatgagggaacccagatcgagctgggcatg
tccatcgccgaggtggagaccgacaagatcgtcaacgtgctcgaagccacccacgccggt
atcctgagacgcaagatcgccgatgaaggggacgaactccctgttggcgctctgctggga
gtgatcgccgatgcgtctgtttccgaccaggccattgacgccttcctcgccggcggggca
acggagacggcagcggaagatgcctcggtgccggcagccgaggaaccgcaggctgaatcg
gcagcagcgggacagatcctggacggctcgctgccgctggaggggatgcgcgcggccata
tccaagaccgtgaccacctcatggacgaccatcccgcactatatggtgacggtggccatc
gacatgggcagggcggaggcgctgagcagcgcccagaaacaggccggtaagcgggtctcc
atcaacgacatgctgatcaaggcatcggccctggcaatcggcaagtaccccctgatcaac
gccgcctttagcggcaagaacatcacgctgcacggagacgtgaacgtcgccatggccatc
ggtctggaagaaggagtgatcatgccggtgatcagggaatgccagaagctcccggtccag
caaatcggcgagaggagccgcgaactggtggcactcgccaaggagggcaagctgggcagc
gccgaattgagcggtgggaccttcgccatatccaacatggggatgctgggggtggaggat
tttatcgccatcgtgccgcccaacctgtccgctatcctggccgtcggcatggtcaaggac
gagccggtggtgcgcgacggccaggtggttgctgcccgcatgatgagggtgaccgtttcc
gccgaccaccgggtgcatgacggcgcctatgccgccaaattcctcggtgaactgaagggc
atactggaagcgccggagacgatcctggcctga

DBGET integrated database retrieval system