KEGG   Pelobacter propionicus: Ppro_1043Help
Entry
Ppro_1043         CDS       T00436                                 

Definition
(GenBank) Alcohol dehydrogenase GroES domain protein
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
ppd  Pelobacter propionicus
Pathway
ppd00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:ppd00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    Ppro_1043
Enzymes [BR:ppd01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     Ppro_1043
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     Ppro_1043
    1.1.1.-  
     Ppro_1043
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 ADH_N_assoc AlaDh_PNT_C Shikimate_DH Sacchrp_dh_NADP 2-Hacid_dh_C UDPG_MGDP_dh_N NADH_4Fe-4S
Motif
Other DBs
NCBI-ProteinID: ABK98668
UniProt: A1AMU8
Position
complement(1093244..1094305)
Genome map
AA seq 353 aa AA seqDB search
MKAAKWYAKKDIRVENVPEPAAPKAGEVKIKVAWFGICGSDLHEYLAGPIFIPTENHPLT
GAKAPLILGHEFTGTVVAVGAGVNNVKVGDLVAPDACQHCGECLPCRMGNYNVCEKLAFT
GLMADGAFAEYVNVPAELCYVLPPNFDPQAGAVIEPLATGFKAVRLAGSLMGATVVVFGA
GTIGLGTLMCVKASGAAQIIVVEMSAARKKLAKECGADIILDPKECDVVAEVKRLSPEGT
GADVSFECIGNKFTGPQAIDVLHNCGKAVIVGIFEEPSSFNFFSLSATDKVVIGTLAYTI
DDFAGVAKLLASGKIKAEPMITGKISLDDIVDKGFEELVNNKDAHIKIIVSPT
NT seq 1062 nt NT seq  +upstreamnt  +downstreamnt
atgaaagctgcaaaatggtatgcaaagaaagacattcgagttgaaaacgttcccgaaccg
gccgcccccaaggcgggtgaagtcaagatcaaagtcgcctggttcggcatctgcggttcc
gacctgcatgagtacctggccggtccgatcttcatacccaccgagaaccacccgctgacc
ggagccaaggccccgctgatcctcggccatgaattcaccggcacggtcgtggcagtgggc
gccggcgtaaacaacgtcaaggtcggcgacctggtggcgcccgatgcctgccagcactgc
ggcgaatgcctcccctgccgcatgggcaactacaatgtctgcgaaaaactggccttcacc
ggcctgatggccgatggcgcctttgccgagtacgtcaatgtgccggccgaactctgctac
gtcctgccccccaacttcgacccccaggcgggcgcggtcatcgaaccgctggccaccggc
ttcaaggccgtacgcctggccggttccctgatgggcgccaccgtcgtcgtcttcggagcc
ggcaccatcggtctgggcaccctgatgtgcgtcaaggcctcgggcgcagcccagataatc
gtggtggaaatgtccgccgcacgcaagaaactggccaaggaatgcggcgcagacatcatc
ctcgaccccaaggaatgcgatgtggtcgcggaggtcaagcggctgagccccgaaggcacc
ggcgccgacgtctccttcgaatgcatcggcaacaaattcaccggcccccaggccatcgac
gtactgcacaactgcggcaaggcggttatcgtcggcatcttcgaagagcccagctctttc
aacttcttcagcctgagcgccaccgacaaggtcgtcatcggcaccctggcctacaccatc
gatgacttcgccggcgtagccaagctgctggcaagcggcaagatcaaggccgaaccgatg
atcaccggcaaaatctcgctggacgacatcgtggacaaagggttcgaagaattggttaac
aacaaggatgcccacatcaagatcatcgtcagcccgacatag

DBGET integrated database retrieval system