KEGG   Pelobacter propionicus: Ppro_1644Help
Entry
Ppro_1644         CDS       T00436                                 

Definition
(GenBank) 6-phosphofructokinase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
ppd  Pelobacter propionicus
Pathway
ppd00010  Glycolysis / Gluconeogenesis
ppd00030  Pentose phosphate pathway
ppd00051  Fructose and mannose metabolism
ppd00052  Galactose metabolism
ppd00680  Methane metabolism
ppd01100  Metabolic pathways
ppd01110  Biosynthesis of secondary metabolites
ppd01120  Microbial metabolism in diverse environments
ppd01130  Biosynthesis of antibiotics
ppd01200  Carbon metabolism
ppd01230  Biosynthesis of amino acids
ppd03018  RNA degradation
Module
ppd_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:ppd00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Ppro_1644
   00030 Pentose phosphate pathway
    Ppro_1644
   00051 Fructose and mannose metabolism
    Ppro_1644
   00052 Galactose metabolism
    Ppro_1644
  Energy metabolism
   00680 Methane metabolism
    Ppro_1644
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    Ppro_1644
Enzymes [BR:ppd01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Ppro_1644
Protein phosphatases and associated proteins [BR:ppd01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Ppro_1644
Messenger RNA biogenesis [BR:ppd03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     Ppro_1644
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK DAGK_cat NAD_kinase
Motif
Other DBs
NCBI-ProteinID: ABK99258
UniProt: A1API8
Position
complement(1763563..1764852)
Genome map
AA seq 429 aa AA seqDB search
MNHQEPDFNVERLGECRFPSPMRGVRFTTDGERILYHSRYQEMRPFIDSGREPPSMEMGG
PRERIFFDPSTIACGIVTCGGLCPGTNDVIRALTLSLYHHYGVRRVYGFRYGFEGVVKRH
GHSPLLLTPEVVDRIGELGGTILASSRGPQAPSEMVDYLEELGIAILFTIGGDGTLKGAA
KIAEEAARRGRPISVIGIPKTIDNDVSFLQNTFGFETAVDEAHRAIYAAHTEATGARNGI
GLVKLMGRDSGFIAAYSTLVNSQVNFCLVPEVPFTLAGFLKSLEERLALRGHAVIAVAEG
AGQELLPAATESDASGNVKLGDIGTFLRDAINGHFRAIGTEITLKYIDPSYIIRSQPANS
HDSAFCLLLGHNAVHAGMCGRTCMVVGNWNQQFTHVPIRLATHQRKKIDPKGRLWSSVLA
STGQSREID
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
atgaaccaccaggaaccggatttcaacgtggaacgtctgggcgagtgccgcttcccctct
cccatgcggggggtacgcttcaccaccgacggagaacgtatcctctaccactcccgctac
caggaaatgcgtcccttcatcgacagcggcagggagcccccttccatggagatgggcggt
ccgcgggaacggatcttcttcgacccgtccaccatcgcctgcggcatcgtcacctgcggc
ggcctctgccccggaaccaacgacgtgatccgcgccctgaccttgagcctctaccaccac
tacggcgtgcggcgggtctacggtttccgctacggcttcgagggtgtggtgaagcgccac
ggccactcccccctgctgctcacccccgaggtggtggaccgtatcggtgagctggggggg
acgatcctggcttcctcccgcggcccccaggcgccgtctgaaatggtcgactacctggaa
gaactgggcatagccatcctcttcaccatcggcggcgacggaaccctcaaaggggctgcc
aagatcgccgaagaggcggcccggcggggcaggcccatcagcgtgatcggcatacccaag
accatcgacaacgacgtatccttcctgcaaaacaccttcggtttcgaaaccgccgtggac
gaggcccaccgggccatctacgccgcccacaccgaagccaccggggcacgcaacggcatt
ggcctggtgaagctgatgggacgggactccggcttcattgccgcctactccaccctggtc
aacagccaggtcaacttctgccttgttcccgaggttcccttcaccctggccgggttcctg
aagagcctggaggaacgtctggccctgcgcggccatgcggtgattgccgttgccgaggga
gcgggccaggagctgctgccggccgccacggagagtgacgcatcgggtaacgtcaaactg
ggcgacatcggcacctttctgcgggacgccatcaacggacacttccgcgccatcggcacg
gagatcaccctcaagtacatcgacccaagctacatcatccgcagccagccggccaactcc
cacgattcggctttctgcctgctgctgggacacaacgccgttcatgccggcatgtgcggc
aggacctgcatggttgtggggaactggaaccagcagttcacccatgtccccatcaggctc
gcaacccaccagaggaagaagatcgaccccaaggggcgactctggagcagcgtcctggca
tccaccggccagtcccgcgagatagactga

DBGET integrated database retrieval system