KEGG   Pelobacter propionicus: Ppro_1716Help
Entry
Ppro_1716         CDS       T00436                                 

Definition
(GenBank) succinyl-CoA synthetase (ADP-forming) beta subunit
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
ppd  Pelobacter propionicus
Pathway
ppd00020  Citrate cycle (TCA cycle)
ppd00640  Propanoate metabolism
ppd00660  C5-Branched dibasic acid metabolism
ppd01100  Metabolic pathways
ppd01110  Biosynthesis of secondary metabolites
ppd01120  Microbial metabolism in diverse environments
ppd01130  Biosynthesis of antibiotics
ppd01200  Carbon metabolism
Module
ppd_M00009  Citrate cycle (TCA cycle, Krebs cycle)
ppd_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:ppd00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Ppro_1716
   00640 Propanoate metabolism
    Ppro_1716
   00660 C5-Branched dibasic acid metabolism
    Ppro_1716
Enzymes [BR:ppd01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Ppro_1716
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 ATP-grasp
Motif
Other DBs
NCBI-ProteinID: ABK99328
UniProt: A1APQ8
Position
complement(1840902..1842086)
Genome map
AA seq 394 aa AA seqDB search
MKIHEYQAKDILAGFGIAIPRGRVAMNASQVERAARELGGHCVIKAQVYAGGRGKGGGIR
VAQDPGQAGEIAKELLGTKLVTPQTGPEGLEVRRLLVEEVVDIERELYLSITLDRESSRY
CLIASAEGGMDIEEIARTAPDRIRILTIDPFIGLRSYQARRTALGLGLVGPLCEECVELI
LNLYRCLLERDCSLVEINPLVVTNAGWLVAMDTKMTFDDNALQRHCEYPDLVDYSQLNPL
EIAAARFDLSYIKLSGAIGCMVNGAGLAMATLDVLKEAGGEPANFLDVGGGASREKVAEA
FRIILQDRDVRGVFVNIFGGIMRCDIIAQGIIDAASGGGCRLPIVVRMDGNRVEEGKQLL
RESGLNIRIGENMGDGAQQIVAMLNREVNQPCQS
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatccatgagtaccaggccaaggatatcctggctggcttcggcatcgccatcccg
cgcggccgggtggccatgaacgccagtcaggtggagcgcgccgccagggagttgggcgga
cattgcgtcatcaaggctcaggtctacgccggcggccgcggcaagggaggcggcatcagg
gtggcccaggatcctggccaggccggcgagatcgccaaagagctgttgggcacaaaactg
gtcacgccccagaccgggcccgagggactggaggtacgccgcctgctggtggaggaggtc
gtggatatcgaaagggaactgtacctctccatcaccctggaccgggagagctcccgctac
tgcctgatcgcatcggctgaggggggcatggacatcgaggagatcgcccgcacggcgccg
gacaggatccggatactgaccatcgatccctttatcgggctgcgttcctatcaggcgcgc
aggaccgccttggggctggggctggtcggcccactctgcgaggagtgcgtggaattgatc
ctcaacctgtaccgctgcctcctggagagggactgctccctggtggagatcaacccgctg
gtggtgaccaacgccggctggctggtggccatggacaccaagatgacctttgacgacaac
gccctgcagcgccactgcgagtaccccgacctggtggactactcccagctcaacccgctg
gagatcgccgccgccaggtttgatctctcctacatcaaactctccggcgccatcggctgc
atggtcaacggcgccggcctggccatggccaccctggacgtgctcaaggaggcaggtggc
gagccggccaacttcctggacgtggggggcggcgccagccgggagaaggtggccgaggcc
ttccgcatcatcctgcaggaccgggacgtgcggggagtgttcgtcaacatcttcggcggg
atcatgcgctgcgacatcatcgcccaggggatcatcgatgccgcctccggcggtggttgc
agactgccgatagtggtgcgcatggatggcaaccgggtcgaggaggggaaacagttgctc
cgtgagtccggcctgaacatccgcatcggcgagaacatgggcgacggagcccaacagatc
gtcgccatgctgaaccgggaggtgaaccagccatgtcaatcctga

DBGET integrated database retrieval system