KEGG   Pelobacter propionicus: Ppro_2395Help
Entry
Ppro_2395         CDS       T00436                                 

Definition
(GenBank) L-threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
ppd  Pelobacter propionicus
Pathway
ppd00260  Glycine, serine and threonine metabolism
ppd00750  Vitamin B6 metabolism
ppd01100  Metabolic pathways
ppd01110  Biosynthesis of secondary metabolites
ppd01120  Microbial metabolism in diverse environments
ppd01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:ppd00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Ppro_2395
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Ppro_2395
Enzymes [BR:ppd01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Ppro_2395
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thr_synth_N PALP
Motif
Other DBs
NCBI-ProteinID: ABL00002
UniProt: A1ARN1
Position
complement(2593450..2594835)
Genome map
AA seq 461 aa AA seqDB search
MRYISTRGGIQPINFKDAVMMGLATDGGLLLPESYPQISRQELDQWRSLSYPDLALRIIS
PFVDDIPVDDLKGLIQRSYATFNHPQVTPVVHRDGVHILELFHGVTLAFKDVALQLLGNL
FEYILAERGERLNILGATSGDTGSAAIHGVRGKKGITIFILHPHGKTSPVQALQMITVGD
ANVHNIAIRGTFDDCQNMVKALFNDLQFKEKYSLGAVNSINWARVLAQVVYYFYAWLRVT
DEGDRPVCFSVPTGNFGDIFAGYVAKRMGLPMGRLLLATNENNILTRFVRDGDYSLANVV
ATVSPSMDIQLASNFERYLFHLYDQDPGRVRAAFAELRECGRISFTPAEMEQVRADFCSA
TVDQAATLETIGSFNRETGYLLDPHTAVGVRAALDLLPSDAARVCLATAHPAKFGEAVEK
AVGTPAPVPGSIAALAGMETRCTVMDADLEKVRQFVVEHVA
NT seq 1386 nt NT seq  +upstreamnt  +downstreamnt
atgcgttatataagcacccgcggcggtattcagccgatcaacttcaaggacgccgtcatg
atgggattggcaaccgacggcggcctgctcctacctgaatcatacccccagatcagccgt
caggagctggatcagtggcgttccctttcttatcctgacttggccttgcggatcatctcc
cccttcgtggacgacataccggtcgacgaccttaaggggttgatccagcgctcctacgct
accttcaaccatccccaggtgacgccggttgtacacagggatggcgtccatatcctggag
ctgttccacggcgtgaccctggctttcaaggatgtggccctgcaacttttgggtaatctg
ttcgagtatatcctggcggagcggggagaacggctcaacatcctgggcgccacctcgggt
gacacagggagcgccgctatccatggggtgcgcggcaagaaggggataaccatcttcatc
ctgcacccccacggcaagacctcaccagtgcaggcgctgcagatgatcactgtcggtgac
gcaaacgtgcacaatattgccatccgcggcaccttcgacgactgccagaacatggtaaag
gctctgttcaacgacctccagttcaaggagaagtactccctgggcgcggtcaactccatc
aactgggcccgcgtcctggcccaggtggtgtactacttctatgcctggctacgggtgacc
gacgagggtgaccggccggtctgcttctctgttcccaccggtaacttcggtgacatcttt
gccggctacgtggccaagcgcatggggctccccatgggacgtctgcttttggcgaccaac
gagaacaacatcctgacccgtttcgtcagggatggcgactactccctggccaacgttgtc
gccaccgtctccccctcaatggacatccagttggcttccaactttgaacgttacctgttt
catctgtatgaccaggatccgggccgagtgcgggctgcctttgccgagttgagggagtgt
gggcgcatcagttttaccccggccgagatggagcaggttcgggcggatttttgttccgcc
acggtggaccaggccgctaccttggagaccatcggcagcttcaaccgggaaaccggctat
ctgttggacccgcacaccgccgtgggggtgcgggctgctctggacctgctcccctctgat
gcggcccgcgtctgtctggcaactgcccatccggccaagtttggagaagccgtggaaaag
gcggtggggacgcccgctccggttcctggttccattgcggccctggccggcatggagaca
cgctgtaccgtaatggatgccgatctggagaaagtgcgccagttcgttgttgagcatgtg
gcgtaa

DBGET integrated database retrieval system