KEGG   Pelobacter propionicus: Ppro_3769
Entry
Ppro_3769         CDS       T00436                                 

Definition
(GenBank) type IV secretory protease
  KO
K12062  conjugal transfer pilin signal peptidase TrbI
Organism
ppd  Pelobacter propionicus
Brite
KEGG Orthology (KO) [BR:ppd00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:ppd02044]
    Ppro_3769
Secretion system [BR:ppd02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   Ppro_3769
SSDB
Motif
Pfam: Peptidase_S26
Other DBs
NCBI-ProteinID: ABL01358
UniProt: A0R7Q0
Position
pPRO1:complement(144094..144480)
AA seq 128 aa
MSITKSLSHRLYWLDKDTAKIKYGDYVLFRHSDVATQFIEQTMIKLVKCDEGDVLTVNEK
KELYCNNAFIGRAKDKALNGKKLVNFVWNGPVPPGMFLPMGDHKDSYDGRYYGFLPKSKV
LKKAHPVF
NT seq 387 nt   +upstreamnt  +downstreamnt
gtgagcatcaccaaatctctgagccacagactgtattggcttgataaagacactgcaaag
ataaagtacggcgactacgttctttttaggcacagcgacgttgcaacacagtttatagag
caaacaatgataaaactggtgaaatgcgacgaaggtgatgtgcttacagtaaatgaaaaa
aaagagctttactgtaacaatgcatttattggtcgagcaaaagataaggctctgaatgga
aaaaagcttgtcaacttcgtctggaacggtccagttcctccgggaatgttcttaccgatg
ggtgaccataaagattcatacgatggcaggtactacggatttttgccgaaaagcaaagtt
ttgaaaaaagctcacccagtattttga

DBGET integrated database retrieval system