KEGG   Pelobacter propionicus: Ppro_3771
Entry
Ppro_3771         CDS       T00436                                 
Name
(GenBank) hypothetical protein
Organism
ppd  Pelobacter propionicus
SSDB
Motif
Pfam: TrbC_Ftype
Other DBs
NCBI-ProteinID: ABL01360
UniProt: A0R7Q2
Position
pPRO1:complement(145175..146125)
AA seq 316 aa
MVFALTLVPTLAGAAGFIETPDECYMVKTMDKPAKTIQLAAMGRCQGRPGRVFVDLDGEV
TVLRDGAVWKRQTVQPMSMPDLVGTMVKAKEMAKSMVLPKNAFEKEMQAKAAETIAVYRS
PEYQAKLARETARIKREMFHEQLEAIPADRGGAKQVKALAKQESPKRARLQDDERIYVFI
SSSMPMETIRNYAVSAGQYNDPKKVVLVMRGFIGGMQKIGPTTSFVADVLKRSATCNLAA
GEQCDMVNTNVLIDPILFRRYGIREVPATVYAKGVKVNLPEQSEGNDDVVVGSFAVAYGD
ASLEYNLSKIAGSVSR
NT seq 951 nt   +upstreamnt  +downstreamnt
atggtttttgctctcacgcttgtacccaccttggctggtgcggcaggctttattgagacc
cctgatgaatgttacatggtcaagacaatggacaagcccgcaaagactattcagctcgct
gctatgggtcggtgtcaggggaggccaggccgggtttttgtggaccttgatggagaggtc
acggttttacgggatggggcagtatggaagagacaaactgttcagccaatgtctatgcct
gatctagtgggaactatggtgaaggcgaaggagatggcaaagtccatggttttgcccaaa
aacgcttttgagaaggaaatgcaggcgaaagcagctgagacgatagccgtttacaggtcc
cctgaataccaggcaaaactcgccagagaaacggcgaggataaagagggagatgttccat
gaacagttggaggcgatccctgccgacagggggggggcgaagcaagtcaaggcgctcgcc
aaacaggagtctccaaagcgggctcgcctgcaggatgatgagcgcatctacgtttttatt
tcgtcttcaatgcccatggaaacgattcgtaattatgcggtgtcggctggccaatacaat
gaccccaaaaaggttgttttagtgatgagggggttcattggtggcatgcagaagataggg
ccgacaacaagtttcgttgccgacgtgttgaagaggtctgcaacgtgtaatctggcggcc
ggtgagcaatgtgatatggtgaataccaatgtgctgatcgatccgatactttttcggcga
tatggaatccgggaagtgccggccactgtatatgcaaaaggagtaaaggttaatttgcct
gagcagagcgaaggtaatgatgatgttgtggtcggatcctttgcggttgcgtatggtgac
gcctcgcttgaatacaatttgagcaagattgctggatctgtttccagatag

DBGET integrated database retrieval system