KEGG   Pelobacter propionicus: Ppro_3772
Entry
Ppro_3772         CDS       T00436                                 
Name
(GenBank) TraU family protein
  KO
K12060  conjugal transfer pilus assembly protein TraU
Organism
ppd  Pelobacter propionicus
Brite
KEGG Orthology (KO) [BR:ppd00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:ppd02044]
    Ppro_3772
Secretion system [BR:ppd02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   Ppro_3772
SSDB
Motif
Pfam: TraU
Other DBs
NCBI-ProteinID: ABL01361
UniProt: A0R7Q3
Position
pPRO1:complement(146125..147114)
AA seq 329 aa
MTRIVVFAILLLCAAANSFAGVINPVTDVCWRCMFPMTTGGVSWGDAGEPAAGNVTTPVC
TCVGTSGVRIGVTASFNEHAWLIESVKTPYYFPALGTKLNNTSPGYNAGDTRGATGQHVR
ESFHHVHQYTFPVYGIVGLFLDMPCLEQDSFDLAYMTEVDDMWSEDLLAMLINPEALAFG
NPVTQMSCISDAVAAGAGYPIDSLFWCFGSWGSSYPLTGTTVIDDPVTAAAATASRMIFK
LGREGALWDTGIDECSSRGVLTPFMVKSHYKFQIARPVVGNQCVPIGRTALLWGPGKNPI
VGGAGKVDEFLWVATRRRVCCVAYNLTDQ
NT seq 990 nt   +upstreamnt  +downstreamnt
atgaccagaatagtggtttttgcgatcttgttgctttgtgccgcggcaaattcgtttgcc
ggagttattaatccagtaacggatgtttgttggcgctgcatgtttcctatgacaacaggt
ggggtttcctggggagatgctggggagccggcggcgggaaatgtgacaacaccagtctgt
acttgcgtcgggaccagcggcgtaaggataggggtaactgcctcattcaatgagcatgct
tggctgattgaatcggtgaagactccctattattttcctgcgttgggaacaaaattgaac
aatacgtctccaggctataacgcaggggatacacgcggagcaacaggtcaacatgttcgt
gagtcgtttcatcatgtgcatcagtacacgtttcccgtgtatggaattgtggggcttttc
cttgatatgccatgtttggaacaggattcctttgaccttgcctacatgacagaagttgat
gatatgtggtctgaagatcttctggccatgctgatcaatccagaagctcttgcgttcgga
aacccggtaacccagatgtcatgcatatctgatgctgttgcggcgggtgcgggctatccc
attgactcgctgttttggtgcttcggatcgtggggctcgtcatatccactgaccggtaca
actgtaattgacgatcctgtgacggctgctgctgctactgcgtccaggatgattttcaag
ctcgggagggaaggcgccttgtgggacacgggaattgacgagtgttcgagtagaggtgtt
ttgactccgttcatggttaagtctcactataaatttcagattgctcggccggtagtcggc
aatcagtgtgtaccgataggaaggactgcacttctttggggccctggcaaaaacccgatt
gttggcggtgcaggaaaagttgatgagtttctgtgggtagcaacaaggaggcgggtgtgc
tgcgtcgcgtacaacttaacagatcaataa

DBGET integrated database retrieval system