KEGG   Pelobacter propionicus: Ppro_3774
Entry
Ppro_3774         CDS       T00436                                 
Name
(GenBank) conserved hypothetical cytosolic protein
  KO
K12061  conjugal transfer pilus assembly protein TraW
Organism
ppd  Pelobacter propionicus
Brite
KEGG Orthology (KO) [BR:ppd00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:ppd02044]
    Ppro_3774
Secretion system [BR:ppd02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   Ppro_3774
SSDB
Other DBs
NCBI-ProteinID: ABL01363
UniProt: A0R7Q5
Position
pPRO1:complement(147659..148261)
AA seq 200 aa
MKHLLFAAIIIAHTCNAIGSEIVTGMTYQISERDALEELEERVQKADWKKHIQSIKPNKY
RPSNLIELPRARGASKFLVDMSYTVESDILNNKGELLYPKGYTFNPLDFISFEKTLVVIN
GDDPKQVRWFKSSSLKNKINVSLFLTQGDAISTSKDLARPVYYATKPLVARFQLRSVPSV
VKASGRCMEVEEIFINGGKD
NT seq 603 nt   +upstreamnt  +downstreamnt
gtgaaacatttactgtttgctgcgataataatcgctcatacctgtaatgccattggtagt
gaaatagttactggcatgacataccaaatatcagaaagagacgcactagaagaacttgaa
gagcgtgtacaaaaagctgattggaaaaaacatatacagtcaataaaaccgaataaatac
cgtcctagcaatttaattgagcttcctagagctagaggtgcaagcaaatttctggttgat
atgagctataccgtcgaatcagatattttaaataataaaggagaacttctgtacccgaaa
ggatataccttcaatccgctagactttatatcatttgagaaaactctcgtagttattaat
ggcgatgatcctaaacaggtcagatggttcaagtcttctagtttaaaaaacaagatcaat
gtatctttattcttaacccaaggtgatgcgatatctacttcaaaagatctcgctagacct
gtttattacgcaacaaaaccactggtggcacgttttcagcttagatcggtcccatccgtg
gtaaaagcaagtggaagatgcatggaggtggaagagatctttattaatggagggaaggat
tga

DBGET integrated database retrieval system