KEGG   Pelobacter propionicus: Ppro_3782Help
Entry
Ppro_3782         CDS       T00436                                 

Definition
(GenBank) conserved hypothetical membrane protein
Organism
ppd  Pelobacter propionicus
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TraL
Motif
Other DBs
NCBI-ProteinID: ABL01371
UniProt: A0R7R3
Position
pPRO1:complement(158157..158423)
Genome map
AA seq 88 aa AA seqDB search
MKYRFPQYLSLPYRVLWFEMDDLMFFLMSIVIAQSVGGWAWLGLIIIPCMCTKVKRNYPR
GFTKHMLYYIGLINFKNYPDHFIKEFVE
NT seq 267 nt NT seq  +upstreamnt  +downstreamnt
atgaaatataggtttcctcaatatttatcactgccatatcgagtactctggtttgaaatg
gatgacttgatgttcttccttatgtccatagtgatagctcaatcggtaggtggttgggca
tggctagggcttattattattccgtgcatgtgcactaaagtaaagcggaactatcctagg
ggattcacgaaacatatgctttactatatcggtctaattaacttcaagaactatcctgac
catttcataaaggagtttgtagaatga

DBGET integrated database retrieval system