KEGG   Pelobacter propionicus: Ppro_3801
Entry
Ppro_3801         CDS       T00436                                 
Name
(GenBank) conserved hypothetical protein
  KO
K12072  conjugative transfer pilus assembly protein TraH
Organism
ppd  Pelobacter propionicus
Brite
KEGG Orthology (KO) [BR:ppd00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:ppd02044]
    Ppro_3801
Secretion system [BR:ppd02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   Ppro_3801
SSDB
Motif
Pfam: TraH
Other DBs
NCBI-ProteinID: ABL01389
UniProt: A0R7T1
Position
pPRO1:177324..178811
AA seq 495 aa
MKVQKTTIRRAAVCVALMLLTLPTIARSGWVDDWITSKQSASPSSFQGATRGYYTGGSFQ
AHWKDSNDYLMTVSTPHIKSGCGGIDTFMGGFAFMDVDYLVQKLQRIMSAAPAAAFDIAL
KAVSPQISGTLKELGAWADALNNLQLDDCKASKALVATIASPASNLLGEKMQSELSSAQS
DFWTSSGMGDLYTKVTGLFKSEQKDVASGNASTAPTIQATAQGSIAGCPQEIVDLYGQGS
FLDNIAAKKNLPTAYVELIRGFVGDVEIIPPATTGSTFVARVVDSCDDNASPVAFLMGHT
SSKASPTASCQQITDTNRSLVTYSVNMLTSIITKMKTKVAYSLAEQDFLGSMPPGVYNYL
RAAASTKMESATVAELANIASNALAYYMLSDLFIKIQQLPDAVAHINSSSVGAKSGADPA
TCQLSLLNPTKAQFEVVLERIHQKMLEIKENYTAVMAESNTIGDLQRRMQAADETVYAEL
KGRFTKGIADHLARR
NT seq 1488 nt   +upstreamnt  +downstreamnt
gtgaaagtccagaaaaccacgatacggagagcagctgtatgtgtcgcactcatgttgctt
acccttccaacaatcgcacgatcagggtgggtggatgactggataaccagtaagcagagc
gcgagcccttcgtcgtttcaaggagcaactcgcggttattataccggtggctcattccaa
gctcactggaaagacagcaacgactatctcatgaccgtctcgactccgcatatcaagtcg
gggtgtggtgggattgatacattcatgggtggttttgcgtttatggacgttgactacctt
gtgcaaaagttacagcggataatgtccgcagctccggccgcagccttcgacattgcacta
aaggcagtttcgccacagatctccgggacactgaaagagctgggggcatgggctgacgct
ctcaataatttgcagttggatgattgcaaggcgtctaaagcgcttgttgcaacaatagcc
tcccccgcctcaaacctactgggtgaaaaaatgcagtccgagctcagttctgcacaatca
gatttctggacttccagcggtatgggtgacctgtatacgaaggtcacaggtctgtttaag
tccgaacagaaagacgttgcttctggcaatgccagcacggcacctaccattcaggcaaca
gcacaaggctcaatcgctggctgcccccaggagatagttgacctctatggccagggcagt
ttcctggacaacattgctgcaaagaaaaatctacccacagcctatgtggagctgattcgt
ggttttgtcggtgacgtagaaataattcctcctgcgacaactggcagtacatttgtggcc
cgtgttgtggactcatgcgatgacaacgccagcccggtggcatttctgatgggccacaca
agctccaaggcatcacctacagcgtcttgtcaacagattacagacacaaacaggtctttg
gtgacgtattcggtcaacatgttgaccagcatcatcaccaagatgaaaacgaaggtagcc
tactcactggctgagcaggatttcttgggaagcatgcctccgggtgtctacaattacctg
agagctgcagcatcgacaaaaatggagtcggccaccgtggctgagttagcaaatatcgca
agcaatgcgctcgcatactacatgctgtcggacctgttcatcaaaatccagcagctgcct
gatgctgttgcgcatataaactcatcatcggttggggcaaagtctggagccgacccagca
acatgccaactgagcctattgaatccgacaaaagcacaattcgaagtggtccttgaaagg
attcaccagaaaatgcttgagatcaaggagaactacactgctgttatggccgaatcgaat
acgatcggagacctgcaaagacgaatgcaggctgctgacgagacggtgtatgcagaattg
aaaggacgcttcaccaaagggatcgctgatcaccttgcaagacgataa

DBGET integrated database retrieval system