KEGG   Pediococcus pentosaceus ATCC 25745: PEPE_0073Help
Entry
PEPE_0073         CDS       T00409                                 

Definition
(GenBank) glucose 1-dehydrogenase
  KO
K00034  glucose 1-dehydrogenase [EC:1.1.1.47]
Organism
ppe  Pediococcus pentosaceus ATCC 25745
Pathway
ppe00030  Pentose phosphate pathway
ppe01100  Metabolic pathways
ppe01120  Microbial metabolism in diverse environments
ppe01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:ppe00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    PEPE_0073
Enzymes [BR:ppe01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.47  glucose 1-dehydrogenase [NAD(P)+]
     PEPE_0073
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short KR Epimerase THF_DHG_CYH_C F420_oxidored
Motif
Other DBs
NCBI-ProteinID: ABJ67184
UniProt: Q03HY8
Position
81450..82235
Genome map
AA seq 261 aa AA seqDB search
MYKDLQEKVAVITGGSKGIGSAIAKRFGQEKMKVVINYNSDPDGAQKAADEVINAGGEAV
TVQANIATEAGVNQLLETALEKFGDLDVWVNNAGMEIKSPTHEVPLEDWNKVTAIDQTGV
FLGSRTALAYFKKNHKKGNIINMSSVHEQIPWPTFASYAAAKGSVKLFTQTIAMEYAKDN
IRVNAIGPGAINTPINAEKFADKEQYDQTVSMVPMDRIGKPEEVAAGAAWLASDESSYVT
GITLFIDGGMTLYPAFKDGQG
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atgtataaagacttacaagaaaaagtagccgtaattacgggtggttccaaaggtattggc
tcagccatcgccaaacgttttggtcaagaaaaaatgaaagtggtcattaactacaatagt
gatccagacggagctcaaaaggccgctgatgaagtaattaatgctggtggcgaggcagtg
acggttcaagctaatatcgctacagaagccggagttaatcaattacttgaaacggcgctt
gaaaaatttggtgacctagatgtctgggttaataatgctgggatggaaattaaatcacca
actcatgaagtaccgttagaagattggaataaagtaacggcaattgaccaaaccggtgta
tttttaggttcacgtactgctttagcttactttaagaagaaccataaaaagggaaacatt
attaatatgtcttccgtgcatgaacaaattccttggcctacctttgctagctatgcagca
gctaagggaagcgtaaaattgttcactcaaacgattgcgatggaatacgccaaggataat
atccgcgtaaatgccattggacccggagcgattaatactcccatcaatgccgaaaaattt
gctgataaggaacaatatgatcaaacagtcagcatggtacccatggaccggattggtaaa
cctgaagaagtagctgcgggtgcagcatggttagcatctgacgaatccagttatgtaact
ggtattacactatttatcgatggtggaatgacgctttatccagctttcaaggatggacaa
ggttaa

DBGET integrated database retrieval system