KEGG   Pediococcus pentosaceus ATCC 25745: PEPE_0659Help
Entry
PEPE_0659         CDS       T00409                                 

Definition
(GenBank) Asparagine synthase (glutamine-hydrolyzing)
  KO
K01953  asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
ppe  Pediococcus pentosaceus ATCC 25745
Pathway
ppe00250  Alanine, aspartate and glutamate metabolism
ppe01100  Metabolic pathways
ppe01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ppe00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    PEPE_0659
Enzymes [BR:ppe01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     PEPE_0659
Peptidases [BR:ppe01002]
 Cysteine Peptidases
  Family C44
   PEPE_0659
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Asn_synthase GATase_7 GATase_6 DUF3700 MS_channel
Motif
Other DBs
NCBI-ProteinID: ABJ67721
UniProt: Q03GF1
Position
697166..699046
Genome map
AA seq 626 aa AA seqDB search
MCGFAGYINQANVNKDTIKSMADRIKHRGPDDEAFFQDENASMGFRRLSIIDLAHGRQPM
MNSAETKVLTFNGEIYNYKQVREELKELGYEFRTDVDSEVLIHGYDAWGPELLKKLRGMF
AFVIYDKEKQEVFGARDHFGIKPLYYYDDDKTFLWGSEIKSFLEHPNFVKEFNEELLPIH
LSFEFIPSKETMFKNVYKLLPGTYFIHKNGKTETHTYFKFNYDHIDESQTIEEDSKKIRK
IVSDSVDAHMIADVEVGSFLSSGIDSSYVLAEAAKLKPIQSFSLGFRNSKYSELSYSTEF
AKEINQKNTPLYMDGDDYFDILPTIMYYMDEPLSNPSAMQLFYLSKGTRKNVKVALSGEG
ADEFFGGYNTYLEAFTFERYQKMVPSFIRKGLAKAVSGLPRFHGRRFLMRGAQPLSERYY
RVNYVFNQQERDQILRNPALNVDSGAYTQHIFDEVKGKDEMTQMQYFDINTWLPFDILHK
ADRMSMANSLEVRTPLVDREVAKFAATMPIKTRIHKEETKVSLRRAAEAELPERVAKKEK
LGFPSPIANWIKEDKYRKRIEAAFNSDIAKKFFKPEALMHILDEHVNGKSSMQKIFTIYT
FILWYGVFFPEDTNTNTIDLVKRTQV
NT seq 1881 nt NT seq  +upstreamnt  +downstreamnt
atgtgcggatttgctggttacattaatcaagctaatgtaaataaagacacaatcaagtca
atggccgatcgaattaaacaccgaggaccagacgatgaagcatttttccaagatgaaaat
gcgtcaatgggattccgtcgcctatcaattattgatttggcacacggacgtcaacccatg
atgaatagtgctgaaactaaagtattaactttcaatggtgaaatttataactacaaacaa
gttcgtgaagaactaaaagaattaggatatgaatttagaacggatgttgattcagaagtc
ctaatccatggttatgacgcatggggaccagaattacttaaaaaacttcgtgggatgttt
gcctttgtaatttatgataaagaaaaacaagaagtatttggtgctcgtgatcattttgga
atcaagcctctttactactacgatgatgataaaacgttcctttggggttcagaaatcaaa
tcattcctagaacatccaaactttgtgaaggaattcaatgaagaactattaccaatccac
ttaagttttgaatttattccttctaaagaaacgatgtttaagaatgtttacaagcttctt
ccaggaacttacttcattcataaaaatggtaaaacagaaacccatacttactttaaattt
aactacgaccatatcgacgaatcacaaactatcgaagaagattcaaagaaaattcgaaag
attgttagtgactctgtagatgcacatatgattgcagacgttgaagttggtagtttctta
tctagtggaattgattcaagttatgttttagcagaagctgctaaacttaaacctatccaa
tctttctcacttggatttagaaattctaagtatagtgaattaagttactcaactgaattt
gctaaggaaatcaatcaaaagaatacaccactctacatggatggtgatgattactttgat
attttgccaaccatcatgtactacatggatgaaccactatcaaatccatcagcaatgcaa
ttattctatctttccaaaggtactcgtaagaatgtcaaagtggctctttcaggagaaggt
gccgatgaattctttggtggatacaatacttatctagaagctttcacatttgaacgttac
caaaagatggttcctagctttattcgaaaagggttggctaaggcagtttcaggtcttcct
cgtttccatggacgtcgtttcttgatgcgtggggctcagccacttagtgaacgctattac
cgcgtaaattacgtatttaatcaacaagaacgtgatcaaattttacgtaatccagctttg
aatgttgattcaggagcttatacacaacatatctttgacgaagtgaagggcaaagatgag
atgactcaaatgcaatactttgacatcaatacttggcttccatttgatatcttgcacaaa
gctgatcgaatgagtatggctaactcactagaagttcggacaccgttggttgaccgggaa
gtagccaaatttgctgcaaccatgccaattaagactcgaattcataaagaagaaactaag
gtatctcttcgtcgtgctgcagaagctgaattaccagaacgagtagctaagaaggaaaaa
cttggtttcccatctccaatcgccaactggattaaagaagataagtatcgtaaacgaatt
gaagcagctttcaattcagacattgctaagaaattctttaagccagaagctttaatgcat
attcttgatgaacatgttaacggaaaatcaagtatgcaaaagattttcacaatttacaca
tttattttatggtatggagttttcttcccagaagataccaatactaatacaatagattta
gttaagagaactcaagtatag

DBGET integrated database retrieval system