KEGG   Pediococcus pentosaceus ATCC 25745: PEPE_0825Help
Entry
PEPE_0825         CDS       T00409                                 

Definition
(GenBank) guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
ppe  Pediococcus pentosaceus ATCC 25745
Pathway
ppe00230  Purine metabolism
ppe01100  Metabolic pathways
Module
ppe_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:ppe00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    PEPE_0825
Enzymes [BR:ppe01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     PEPE_0825
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin AAA_18 RsgA_GTPase TipAS MMR_HSR1 AAA_22 AAA AAA_16
Motif
Other DBs
NCBI-ProteinID: ABJ67885
UniProt: Q03FY7
Position
830254..830868
Genome map
AA seq 204 aa AA seqDB search
MARRGMLIVLSGPSGVGKGTVRKAIFDQGGNDFQYSISMTTRKPRKGEVDGEDYYFVSKE
EFEKNIKEGQMLEYAQYVDNYYGTPLKYVNQTLDSGRDVFLEIEVNGARQVREKMPDGVF
LFLTPPDLMELKQRIINRGTEDMDTINKRMEKAVDEIKTMRDYDYAVVNDKIENAVEEIK
NIIKGEHLRVTRVYPEYQEMLGEL
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
atggctagaagaggaatgttgattgttctatctggcccttccggtgttggtaagggaacg
gttagaaaggcaatctttgatcaaggcggtaatgattttcagtattcaatttcaatgaca
actagaaagcctagaaaaggtgaagttgatggtgaagattactactttgtctctaaagaa
gaatttgagaaaaatatcaaagaaggccaaatgctggagtatgcccagtatgtagataat
tactatggcacaccattaaagtatgttaatcaaactctagattcaggacgagatgttttc
ctagaaatcgaagtgaacggtgctcgtcaagttcgtgaaaaaatgccagacggggtattt
ttattcttgactccaccagatttgatggaattaaaacaacgtattatcaatcgcgggact
gaagacatggatacgattaataaacgaatggaaaaagcagttgacgaaatcaagacgatg
cgtgattatgattatgcagtcgttaacgataagattgaaaatgcggttgaagaaattaaa
aatattatcaagggtgaacatcttcgagtaaccagagtttatcctgaatatcaagaaatg
ttaggagaattataa

DBGET integrated database retrieval system