KEGG   Pediococcus pentosaceus ATCC 25745: PEPE_1051Help
Entry
PEPE_1051         CDS       T00409                                 

Definition
(GenBank) nucleoside diphosphate kinase
  KO
K00940  nucleoside-diphosphate kinase [EC:2.7.4.6]
Organism
ppe  Pediococcus pentosaceus ATCC 25745
Pathway
ppe00230  Purine metabolism
ppe00240  Pyrimidine metabolism
ppe01100  Metabolic pathways
ppe01110  Biosynthesis of secondary metabolites
ppe01130  Biosynthesis of antibiotics
Module
ppe_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
ppe_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
ppe_M00052  Pyrimidine ribonucleotide biosynthesis, UMP => UDP/UTP,CDP/CTP
Brite
KEGG Orthology (KO) [BR:ppe00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    PEPE_1051
   00240 Pyrimidine metabolism
    PEPE_1051
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ppe04131]
    PEPE_1051
Enzymes [BR:ppe01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.6  nucleoside-diphosphate kinase
     PEPE_1051
Membrane trafficking [BR:ppe04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Kinases and associated proteins
    PEPE_1051
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NDK
Motif
Other DBs
NCBI-ProteinID: ABJ68107
UniProt: Q03FB5
Position
complement(1046069..1046494)
Genome map
AA seq 141 aa AA seqDB search
MEQERILILIKPDGVSLGHIGEVITRLELKGYSIDALKVTQATEAQLQQHYEKLVNKPFF
KEIETYMLEGKIVAMIASGTHVIDVFHRMAGATDPSEAAFGTIRGDLGREWPDGLLRNVV
HSSDSIENAEKEIKIWFPELN
NT seq 426 nt NT seq  +upstreamnt  +downstreamnt
atggaacaagaacgaattttaattttaattaaaccagatggtgttagtttagggcatatt
ggggaagtaattacacgtttagaactgaaaggatattcaattgatgcgcttaaagttacc
caagcgacggaagcacagttgcagcaacattatgaaaaattagttaataaaccattcttt
aaggaaatcgaaacatatatgttagaaggcaaaatcgtggcgatgattgccagtggaact
catgttattgatgtttttcatcggatggcaggtgctacagatccgtcggaagctgctttc
ggaaccattcgtggagacctgggacgggagtggccagacggtttactacgtaatgtggtg
cacagttctgatagcattgaaaatgctgaaaaagaaatcaaaatttggtttccagaatta
aactaa

DBGET integrated database retrieval system