KEGG   Pediococcus pentosaceus ATCC 25745: PEPE_1169Help
Entry
PEPE_1169         CDS       T00409                                 

Definition
(GenBank) ATP-dependent DNA helicase, RecD/TraA family
  KO
K03581  exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
ppe  Pediococcus pentosaceus ATCC 25745
Pathway
ppe03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:ppe00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    PEPE_1169
Enzymes [BR:ppe01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     PEPE_1169
DNA repair and recombination proteins [BR:ppe03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     PEPE_1169
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AAA_30 AAA_19 HHH_4 UvrD_C_2 Viral_helicase1 AAA_11 AAA_22 AAA HHH_5 AAA_23 T2SSE UvrD_C cobW AAA_12 DUF2075 AAA_28 AAA_5 NTPase_1 PG_binding_4 AAA_29 AAA_18 FtsK_SpoIIIE AAA_14 AAA_16 TsaE Peptidase_S21 gpW AAA_33 Helicase_RecD KTI12
Motif
Other DBs
NCBI-ProteinID: ABJ68223
UniProt: Q03EZ9
Position
complement(1168805..1171249)
Genome map
AA seq 814 aa AA seqDB search
MAFEKMNLFGDADPKKQSQNKMVELIGEISAVFFESPDSLFKVLLVTVEEDDFDWSEEQI
VVTGNIGDVQEGQKYQFNGKLIAHPKYGMQIQANQYRAFMPNTEDGVVTYLSGSQFKGIG
TKTAEKIVEALGSDALNEIKKDPGVLNGLNLKEKQIDMIVSVLDQSNGLEDILIKLSDMG
ITGKIASSIVNKYHEDAINIIEENPYRLVEDIENIGFKRADAIAASLNIKPDFEKRIQAG
ILEAIKTWCNATGDTYILADMLLQEARKLLGTAVNAEAIADQVLQLGKDGKVVGEDGQIY
LKWLYNAEVAISYNVKRMVGESNSNVKGIKRAIKAAEKNLNLKYDDTQNAAIELALSHPL
TIITGGPGTGKTTIVKGLINSFAELNDISLDINEYTESKFPIQLAAPTGRAAKRLSQVTN
VPAKTIHRLLGLNGNDDLQNDEIKQLEGDLLVIDEMSMVDTGLFSTLVNAINPDMQVVLV
GDKDQLPSVGPGQIFNDLIKSGKIPTISLTKIYRQEQDSSIIQLAHDIQKGVLPEDFTKN
KKDKSFFLANANQIVDAIDQIAQKAVDKGISKNDIQVLAPMYRGSAGVDEINRHLQKVLN
PPQTDKPKKIESGNQTFRIGDKVLQLVNSPENNIFNGDIGEITGIVMEKQGKGRAHLVVD
YDGNEVTYAKTDLGQLTLAYCISIHKSQGSEFPVVIMPMVHQYYRMLQRNLLYTGLTRAS
NSIILLGEPDAYQRAVSNESSNRNTSLERRINPQVEVLAEKVNQIQVSEPVDQEQSTSEP
VEVEQPKYLTTSMVQKEQVDPMIGMEGVTPYDFI
NT seq 2445 nt NT seq  +upstreamnt  +downstreamnt
atggcatttgagaaaatgaatttatttggcgatgctgacccaaaaaagcagtctcaaaat
aagatggtcgaactgattggtgaaattagtgcggtcttttttgagagcccagatagttta
tttaaagtgctcctggttactgtagaagaagatgattttgactggtccgaagagcagatt
gtcgttactggaaatattggtgacgtacaagaaggacagaagtatcaatttaatggaaaa
ctaattgcacatcctaagtatggtatgcaaattcaagctaatcaatatcgagcgtttatg
ccaaatacagaagatggtgttgttacatatttgtcgggatcacaattcaaaggaattgga
acgaaaaccgctgaaaaaattgttgaagctttgggatcggatgcacttaatgaaattaag
aaagaccctggagttttaaacggtctaaaccttaaagaaaagcaaattgatatgattgta
tcggttttggaccagtccaatggattagaggatatccttataaagctcagtgatatgggg
attacaggaaaaattgctagtagtatcgtaaataaataccatgaggatgcaattaacatc
attgaagagaatccctaccgattggtcgaggatatcgaaaatattggttttaaacgagct
gatgctatcgctgctagcttaaatattaaaccggattttgaaaaacgaattcaagcagga
attttagaagcaattaaaacttggtgtaatgccacaggtgatacttatattttggcagat
atgctactccaagaagcccgaaagcttttaggtacggctgtaaatgctgaagctattgca
gatcaagttttacagctaggtaaagatggaaaagtcgtaggtgaggacggccaaatttat
ctgaaatggttatataatgctgaggtcgctattagttataacgttaaacgcatggtcggt
gaatcgaattcgaacgttaaaggtattaagcgggcaatcaaagccgctgaaaagaatcta
aatttaaagtatgatgatacgcagaatgcagcgattgaacttgcactttcacatcctctg
acaattattactggtggcccagggacagggaagactacaattgttaaggggttaattaat
agctttgcagaattaaatgatatttcgttggatattaacgaatatacggaaagtaaattc
cccattcagttagcagccccaactggtcgagcagctaaaagattaagccaagttacgaat
gtaccagctaaaactattcatcgtttgctagggttaaatggtaatgacgatctccagaat
gatgaaataaagcagcttgaaggcgatttgttagttatcgacgagatgtctatggttgat
actggattatttagtacgttggttaatgccattaatccagatatgcaagtggtattggta
ggagataaagaccaattaccatcagttggaccaggacaaatatttaatgatttaattaaa
agtggtaaaattccaaccatttcgttaacaaaaatttatcgtcaagaacaagattcatcg
attattcagttagcccacgatatccaaaaaggggtattacctgaagattttaccaaaaat
aaaaaagataaatccttctttctagccaacgctaatcaaattgttgacgcaatagatcaa
atcgcgcaaaaagctgtagataaagggatttctaagaatgatattcaagttttagcaccg
atgtatcgaggtagtgcaggagtagatgaaattaaccgacatctacaaaaagttttaaat
ccacctcaaacggataaaccgaagaaaatcgaatctggcaatcaaacttttagaattggt
gataaagttttgcaattggttaattcacctgaaaataatatctttaatggtgatattggc
gaaattaccggaatcgttatggaaaagcaaggcaaaggcagagctcatctagtcgttgac
tatgatggaaatgaggttacgtatgctaaaactgaccttggacaattgaccttggcatat
tgtatttcgattcataaatcacaaggtagtgaatttccggtggtgattatgcctatggtg
catcaatactatcgaatgttacaacgcaacctcttatatacagggctaactcgtgcgtcc
aattcgattattttgttgggtgaacctgatgcttaccaaagagcggtaagcaatgaatca
tctaatcgaaataccagtttagaacgtcgaattaatccgcaagtagaagttttagctgaa
aaagtaaaccaaatacaagtatcagaaccagttgatcaagagcaatcaacgtcagagcca
gtggaagtagagcaaccaaagtatttaactacgtcgatggttcaaaaagaacaggtagac
ccaatgattggaatggaaggggtcacaccgtatgattttatttag

DBGET integrated database retrieval system