KEGG   Pediococcus pentosaceus SL4: T256_08795Help
Entry
T256_08795        CDS       T02906                                 

Definition
(GenBank) SAM-dependent methyltransferase
  KO
K00563  23S rRNA (guanine745-N1)-methyltransferase [EC:2.1.1.187]
Organism
ppen  Pediococcus pentosaceus SL4
Brite
KEGG Orthology (KO) [BR:ppen00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:ppen03009]
    T256_08795
Enzymes [BR:ppen01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.187  23S rRNA (guanine745-N1)-methyltransferase
     T256_08795
Ribosome biogenesis [BR:ppen03009]
 Prokaryotic type
  rRNA modification factors
   23S rRNA modification factors
    T256_08795
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Methyltransf_25 Methyltransf_11 Methyltransf_31 Methyltransf_23 Methyltransf_12 NPC1_N CMAS TPMT N6_N4_Mtase MTS TF_Zn_Ribbon
Motif
Other DBs
NCBI-ProteinID: AHA05817
Position
1717537..1718376
Genome map
AA seq 279 aa AA seqDB search
MNKIELATQFIQRHLHQFQCPICKSNFNEVQSGTLICNNQHSFNIAKKGSLFFLNNPVNT
EYTNEMLTYRNQFLTAGFFNPMLEEVINNISGDLILDAGCGEGTTTKWMASHFDGDFVGL
DISKPAINIAGFGIAPQPYPLFMVGDLAQLPFADQGLTSIVNILSPANYQEFDRTLATHG
ELIKVIPGNHYLSELRQLVYPDGEHATYDNAPVKNHFIEHYEHVEFSKISYKFPLDDKLF
TALFNMTPLTWQAQDRKEAILQDGLKEITAEFEIGVVRK
NT seq 840 nt NT seq  +upstreamnt  +downstreamnt
ttgaataaaatcgaattagcaacccaatttatccaacgacacttacaccaatttcagtgt
cccatctgtaaatcgaatttcaatgaagttcaatccgggactttaatttgtaataatcag
cattcatttaatattgccaaaaaaggaagcctcttctttttaaataatcctgttaacact
gaatatactaatgagatgttaacttatcgaaatcagtttttgacggctggttttttcaac
ccgatgttagaagaagttatcaataatatttcgggagatttaattttagatgcaggttgt
ggagaaggaactactactaaatggatggcatctcatttcgacggagacttcgtgggtttg
gatatctctaaaccagcgattaatattgccggctttggaattgctcctcaaccctatcct
ttatttatggtgggcgatttagctcaattacctttcgcagatcaaggtttaacttcaatc
gtcaacattttatctccagccaattatcaagaatttgatcgaacgctggcaacccatggt
gaattaattaaagtgattcctggaaatcattatctaagtgaacttcgacaactcgtctac
cctgatggtgaacatgcgacctatgataatgctccggttaaaaaccattttatcgaacac
tatgaacacgtcgaattttctaaaatcagctataaatttccgcttgatgacaaattattc
acggcccttttcaatatgacacctttaacttggcaagctcaggatcgtaaagaggctatt
ttacaagatggattaaaagaaatcacggcggaatttgaaattggtgtagttcgtaaataa

DBGET integrated database retrieval system