KEGG   Paenibacillus peoriae: ABE82_05230Help
Entry
ABE82_05230       CDS       T04053                                 

Definition
(GenBank) cellobiohydrolase
  KO
K19668  cellulose 1,4-beta-cellobiosidase [EC:3.2.1.91]
Organism
ppeo  Paenibacillus peoriae
Pathway
ppeo00500  Starch and sucrose metabolism
ppeo01100  Metabolic pathways
ppeo02020  Two-component system
Brite
KEGG Orthology (KO) [BR:ppeo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    ABE82_05230
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    ABE82_05230
Enzymes [BR:ppeo01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.91  cellulose 1,4-beta-cellobiosidase (non-reducing end)
     ABE82_05230
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_6 CBM_3 fn3 LTD
Motif
Other DBs
NCBI-ProteinID: ALA44770
UniProt: A0A0K2FGK5
Position
1209109..1211223
Genome map
AA seq 704 aa AA seqDB search
MKYAFALSLVASSFLPGAGFTDKIHAESHVDNPYQGATKYVSPDYAASVDTSIAKITDAN
LKAKMQTVKTFPTAVWLDRIAAINGGGGKLGLEAHLDQVLAQKKGSTPITAEFIVYDLPG
RDCHALASNGELPLTQAGLETYKKDYVDKIASIFANPKYKDIRIVAIIEPDSLPNLVTNL
DDPKCAQAKSTGIYEAGVKYTMNKLNEIPNVYKYVDIGHSGWLGWDNNRAATVSLFTTIF
KDTSKGLSSVDGFITNTANTSPLTEPNLPDPNLNVGGQPIKSSKYYEWNPNFDESDFAES
LHRDFVSAGWPSSLGMLIDTGRNGWGGPNRPTSAVGNDINSYVNSGRVDKRSHRGNWCNN
SGAGMGTPPQTAPAGHIDAYVWAKPPGDSDGSSSLIPNDEGKGFDRMCDPTYTTKDGTLT
DALPNAPISGAWFHDQFVMLVQNAYPAIVPSTGGVDPAPTAPAVPSGLKAVVGNAQVTLT
WNASTGADSYTVKRATSEAGPFTAVAPLVTEREYTDKGLTNGTTYFYVVSATNAKGTSKD
SATVSAEPKGTPTDPTDPTEPAGDLVVMYRAGDTDPANNAVKPFLNLKNKGTTPVKLSEL
KIRYYFTKDGSQELQSAVDYAQVGNDNVLRTITDNYIEIGFSAAAGTLAAGAQTGDIQIR
MNNSDWSNLNESNDYSFDPTKTSYAEWNKVTLFHNDKLVWGIEP
NT seq 2115 nt NT seq  +upstreamnt  +downstreamnt
atgaagtatgcttttgcgctatcactcgtcgcaagcagctttctaccaggtgcaggattt
acggataaaatacatgcagaatcccatgtggacaatccttaccaaggggcgacaaaatat
gttagtcctgattatgcggctagtgttgatacatcgattgccaagattacggatgccaat
ctgaaagcaaaaatgcaaacggtcaaaacattcccgacagccgtatggcttgatcgtatc
gctgctattaacggcggtggaggcaagcttggcctggaagcgcatttggaccaagtattg
gcgcaaaagaaaggcagcacaccgattacggcggaatttattgtgtatgatctgcccgga
cgggattgtcatgccttggcttccaatggtgaattaccgctgactcaggcagggctggaa
acatataaaaaggattatgttgacaaaattgcttctattttcgcaaatcccaaatataag
gatattcgtatcgtagcgatcattgaaccagatagtttgccaaacctggtaaccaatctg
gatgatcctaaatgtgcgcaagccaagtctacagggatttatgaagctggtgttaagtac
acaatgaataagctgaacgagattccgaatgtgtacaaatacgtagatatcggtcactct
ggctggttaggttgggataacaaccgtgcagcaacggtatccctgtttacaactatcttc
aaagacactagcaaaggtctgtccagtgtagatggctttatcacgaatacagccaatact
tcaccgctgacagaacctaatttgcctgatccaaatctgaatgtcggcggacaaccgatc
aaatcgtccaagtactatgaatggaatcctaatttcgatgaatcggatttcgcagagtca
ttgcatagagattttgtcagcgcaggctggccgagctcactcggtatgttaattgataca
ggccgtaacggatggggcggacctaaccgtccgacttccgcagtcggcaatgatattaac
tcctatgtaaactcaggccgtgttgacaaacgctcgcaccgtggtaactggtgtaataac
agcggagcaggtatgggaacaccgccacaaacggctccagctggccatattgatgcctat
gtatgggcgaaacctccgggtgattccgatggttccagctcactcattccgaacgatgag
ggtaaaggctttgaccgtatgtgtgatcctacctatacaaccaaggatggcacattgaca
gatgctttaccgaatgcacctatttcaggagcatggttccatgatcagtttgtgatgctg
gtacaaaatgcgtaccctgcaatcgtgccttccactggtggtgtggacccagcgcctaca
gctccagctgtaccgtcaggcttaaaggctgttgtgggcaatgctcaagtaacactgact
tggaatgcgtctactggtgccgatagctacacggtaaaacgtgccactagcgaagcaggt
ccttttacagccgttgcgcctcttgtaacggaaagagagtacacggataagggactgacg
aacggaacaacttacttctatgttgtaagtgctacgaatgcgaaaggaacaagtaaggat
tccgcaacggtaagcgctgaacctaaaggtacaccgactgatccaaccgaccctacagaa
ccagcgggtgatctggttgtaatgtaccgggctggtgacaccgacccagctaataacgca
gtcaagcctttccttaacctgaaaaataaaggtacaacacccgtgaagctgagtgagctg
aaaatccgctattacttcacgaaggatggcagccaagagctgcaatctgcagtagactat
gcgcaagtaggcaatgataacgtgctgcgtaccattacagacaactatattgaaattggt
ttcagtgctgctgccggcacgcttgctgctggagcgcaaacaggtgatattcagatccgc
atgaacaatagtgactggtctaacctgaacgaatccaatgattactccttcgatccaact
aaaacctcttatgcagaatggaacaaagtaacgttgttccacaatgataagctggtgtgg
ggaatcgagccttag

DBGET integrated database retrieval system