KEGG   Paenibacillus peoriae: ABE82_05970Help
Entry
ABE82_05970       CDS       T04053                                 

Definition
(GenBank) mannose-1-phosphate guanylyltransferase
  KO
K00971  mannose-1-phosphate guanylyltransferase [EC:2.7.7.13]
Organism
ppeo  Paenibacillus peoriae
Pathway
ppeo00051  Fructose and mannose metabolism
ppeo00520  Amino sugar and nucleotide sugar metabolism
ppeo01100  Metabolic pathways
ppeo01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ppeo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    ABE82_05970
   00520 Amino sugar and nucleotide sugar metabolism
    ABE82_05970
Enzymes [BR:ppeo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.13  mannose-1-phosphate guanylyltransferase
     ABE82_05970
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase MannoseP_isomer Cupin_2 Cupin_3 EutQ Cupin_1 AraC_binding Ppnp NTP_transf_3
Motif
Other DBs
NCBI-ProteinID: ALA41098
UniProt: A0A0K2F5B2
Position
1418614..1419990
Genome map
AA seq 458 aa AA seqDB search
MKLVLLSGGSGKRLWPLSNDSRSKQFLKVLESPEGISESMVQRVWRQLGDNGLSESSFIA
TGRAQVEMIQSQVGPNTRIIVEPERRDTFPAIALTATYLYSIAGVSPDEIIAILPVDPYV
EDAFFASVAQLEHTLQESEGKLALIGVVPSYPSEKYGYIIPKNDATQGSTGYREVSHFQE
KPDREQAERLIERNALWNCGVFAFKLSYLLDILASKGLPLNYEEMQKQYASLEKISFDYE
VVEKEKDIVVLPYDGFWKDLGTWNTLTEEMSNQQVGRGVVTEDCVNTSLINELDIPVAII
GTNDLIVAASPDGILVTNKAESPRIKEVLKAHDQRPMYEERRWGQYRVVDYVKYDEGNEV
LTKRIRVRKGKNISYQLHFKRSEIWTIISGEAEIILNEKLHKVKAGDVVRIPEGTKHSIL
AVTDVDFIEVQTGSELVEEDIVRFCMDWNEISRHQFIS
NT seq 1377 nt NT seq  +upstreamnt  +downstreamnt
atgaagctcgtacttttgtctggtggttccggtaaaagattatggcctttgtccaacgat
tcccgttccaaacaatttttgaaggtactggagagcccggaggggatttcggaatccatg
gtacagcgggtatggagacaattgggagacaacggattatcagaatcttcgtttattgcg
acagggagagcacaggtcgaaatgatccagagtcaggtcgggccgaatacgcgcattatt
gttgagccggaacgcagagacacctttcctgcgattgcgctgacagcgacttatctatat
tccattgcaggtgtttcacctgatgaaattatagcaatattgcctgtagatccttatgtt
gaggatgctttcttcgcttccgtagcccagctggaacatacgcttcaggagagtgaaggc
aagcttgctttaatcggggttgtcccttcctatccttcagagaaatatggttacattatt
ccgaaaaacgatgccactcaaggtagcacaggctaccgtgaagtgagccattttcaagag
aaacccgaccgggagcaggcggagcgtctgattgaacgcaatgctctatggaactgcggg
gtttttgcattcaaattaagttatttgctggatatcttggcatccaaggggttgccgctt
aattatgaagaaatgcaaaagcaatacgcatctctggaaaaaatcagctttgactatgaa
gtagtcgagaaggaaaaggacatcgtagttcttccgtatgatggtttttggaaggatttg
ggtacctggaatacgctcacagaagaaatgtctaatcaacaagtgggcagaggtgtagta
acggaggattgcgtcaatacgagccttattaacgagttagacattcctgtggcgatcatt
ggaacgaatgatctgatcgtagccgctagcccggatggcattcttgtgaccaataaggca
gaaagtcctcgcattaaggaagtgctcaaggctcatgatcagcgtccaatgtatgaagaa
cgtcgttggggacagtatcgggttgtggattatgtcaagtatgacgagggtaacgaggta
ttgaccaaacgaatccgcgtacggaaaggcaaaaatatcagctaccagcttcatttcaaa
cgaagtgaaatctggaccattattagcggtgaagcggaaattattttgaatgagaagctg
cacaaagtgaaggctggtgacgtagtacgtatccctgaagggacgaagcatagcattttg
gcagtgaccgatgtggattttattgaggtgcagactggctctgagttggttgaagaggat
attgtccgcttttgtatggattggaatgaaatttcccgtcaccaatttatctcctaa

DBGET integrated database retrieval system