KEGG   Paenibacillus peoriae: ABE82_06175Help
Entry
ABE82_06175       CDS       T04053                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
ppeo  Paenibacillus peoriae
Pathway
ppeo00071  Fatty acid degradation
ppeo00072  Synthesis and degradation of ketone bodies
ppeo00280  Valine, leucine and isoleucine degradation
ppeo00310  Lysine degradation
ppeo00362  Benzoate degradation
ppeo00380  Tryptophan metabolism
ppeo00620  Pyruvate metabolism
ppeo00630  Glyoxylate and dicarboxylate metabolism
ppeo00640  Propanoate metabolism
ppeo00650  Butanoate metabolism
ppeo00900  Terpenoid backbone biosynthesis
ppeo01100  Metabolic pathways
ppeo01110  Biosynthesis of secondary metabolites
ppeo01120  Microbial metabolism in diverse environments
ppeo01130  Biosynthesis of antibiotics
ppeo01200  Carbon metabolism
ppeo01212  Fatty acid metabolism
ppeo02020  Two-component system
Brite
KEGG Orthology (KO) [BR:ppeo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    ABE82_06175
   00630 Glyoxylate and dicarboxylate metabolism
    ABE82_06175
   00640 Propanoate metabolism
    ABE82_06175
   00650 Butanoate metabolism
    ABE82_06175
  09103 Lipid metabolism
   00071 Fatty acid degradation
    ABE82_06175
   00072 Synthesis and degradation of ketone bodies
    ABE82_06175
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    ABE82_06175
   00310 Lysine degradation
    ABE82_06175
   00380 Tryptophan metabolism
    ABE82_06175
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    ABE82_06175
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    ABE82_06175
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    ABE82_06175
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ppeo04147]
    ABE82_06175
Enzymes [BR:ppeo01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     ABE82_06175
Exosome [BR:ppeo04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   ABE82_06175
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III_C
Motif
Other DBs
NCBI-ProteinID: ALA41137
UniProt: A0A0K2F5U1
Position
complement(1461713..1462897)
Genome map
AA seq 394 aa AA seqDB search
MKKVALVSPLRTAVGSFNKTLAPLSAPELGATVMTACLQQSKLEPSLIDQIYLGNVLQAG
NGQNPARQAALKAGIPIDVPETTINTVCGSGLHAVALAYNSILAEQGNIVLAGGMESMSN
APYLLRNARNGYKLGNGELVDSLVADGLTCPINHYHMGITAENVAEKYGISRLEQDEFSY
QSQIKAVEAKNKKLFEEQIVPVMIKNKKETISFTEDEHIRGNTTKEKLSQLKPAFKENGT
VTAGNASGINDGAAAMLVVSEDKCKEHELKPLAYIKGYSLVGVDPAYMGMGPVKAISSLL
KQQGMSIDDIDLFEINEAFAAQALAVLKELGINPEKVNVNGGAIAIGHPVGASGARVLVT
LVHEMVRRSSRYGIASLCIGTGMGIAMLVENALI
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaagtagctttagtaagcccgttgagaacagcggtcggctcttttaacaaaacc
cttgcgcctctaagcgctcctgaactgggagcaactgtgatgacagcatgccttcagcaa
agtaaattagagccttctttgattgatcaaatttatttgggaaatgttcttcaggcgggc
aatggccaaaatcctgccagacaggcggcactaaaagccggtatccctattgatgtaccc
gaaacaacgataaacacggtttgcggttcaggactccatgccgttgctttagcctacaat
tcaatattggcggaacaaggcaacatcgtcttggccggaggcatggagagcatgtcgaat
gccccttacctgctaaggaatgcaagaaacggctacaaactgggcaacggtgagttggta
gactccctggtggccgacggtcttacgtgcccgatcaaccattaccatatgggaattacc
gcagaaaatgttgcagagaaatatggaatttcaagacttgagcaggatgaattttcctat
caaagccagataaaggccgtagaagctaaaaacaagaagctttttgaagagcagattgtt
ccagtcatgatcaaaaacaaaaaagaaactatttctttcacggaggacgaacacataaga
ggaaatacaacgaaagaaaaactttctcaattaaaacctgcgtttaaggagaacggaaca
gttaccgccggaaatgcttcaggaatcaatgatggcgcggcggctatgcttgtagtgtcg
gaagacaaatgtaaggaacatgagttaaagccgttggcatatatcaagggttattcactt
gttggcgttgaccctgcatatatgggaatgggaccggtgaaggccatttcgtcacttctg
aagcaacagggaatgtctattgatgacatcgatctttttgaaattaatgaagcgttcgcc
gcacaagcactagcggtattgaaagagcttggaatcaatcctgagaaggtgaatgtcaat
ggcggcgcgatcgcgatcgggcatcctgtcggtgcaagcggtgctagggtattggttacg
ctggttcatgaaatggtgcgaagatcttcacgttacggcatcgcctcgttatgcatcgga
acgggaatgggaatagcgatgctagttgaaaatgcactcatttaa

DBGET integrated database retrieval system