KEGG   Paenibacillus peoriae: ABE82_06755Help
Entry
ABE82_06755       CDS       T04053                                 

Definition
(GenBank) fructose-2,6-bisphosphatase
  KO
K02226  alpha-ribazole phosphatase [EC:3.1.3.73]
Organism
ppeo  Paenibacillus peoriae
Pathway
ppeo00860  Porphyrin and chlorophyll metabolism
ppeo01100  Metabolic pathways
Module
ppeo_M00122  Cobalamin biosynthesis, cobinamide => cobalamin
Brite
KEGG Orthology (KO) [BR:ppeo00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    ABE82_06755
Enzymes [BR:ppeo01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.73  adenosylcobalamin/alpha-ribazole phosphatase
     ABE82_06755
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: ALA44783
UniProt: A0A0K2FFT9
Position
1582138..1582890
Genome map
AA seq 250 aa AA seqDB search
MKQDIAAKRTVEYAQSPNSQEDKVPYDAKEDLHWDMELVLVRHGTTLWNKERRYLGHSDL
GLLPGAEQELKPLQEKLQGQSFARIYCSDLMRCRQTLQIIVPESELTSGGSLSTMSPMME
PRLRELHFGEWDGKTYDMLKDVSLYRAWIDEPQRITPPGGESWADFVNRLRKFLDSLYEW
RVAMEVQPMDLTAAPPSVLVVTHGGVIRQLACMLIPGHDFWILNPKPGEAFRIQLRLAGR
HNYIAEMLPH
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
ttgaaacaagatatagcagcaaaaaggacagtagaatacgcacaaagtccgaactcacag
gaggataaggtgccgtatgatgctaaagaagatctgcattgggacatggaactcgtgtta
gttcgtcacggcacaaccttatggaacaaggaacgtcgatatctaggacactccgactta
ggtttgctaccgggagcagagcaggaattaaagcctttgcaagaaaaattgcaagggcag
tcctttgctcgaatctattgcagcgatttaatgcgatgtcgccagaccttgcagatcatt
gtgccggaatcagaattgacgtctggaggttccctatctactatgtctcctatgatggaa
ccacgtctgcgagagcttcattttggtgagtgggatggaaaaacgtatgacatgctcaag
gatgtgtcgttgtatcgcgcttggattgatgagccgcaacggataacccctcctggagga
gagtcttgggcagattttgtgaatcgtctacggaaatttcttgactctctgtatgaatgg
cgtgttgctatggaagttcaacccatggatttgactgctgcgccaccctctgttttggtc
gttacgcatggtggcgtaattcgtcagttagcttgcatgctgataccgggccatgatttt
tggattttgaatccgaagccgggagaagcatttaggattcaattgaggctggcaggacgg
cacaattacatagcagaaatgcttcctcattag

DBGET integrated database retrieval system