KEGG   Paenibacillus peoriae: ABE82_14000Help
Entry
ABE82_14000       CDS       T04053                                 

Definition
(GenBank) dienelactone hydrolase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
ppeo  Paenibacillus peoriae
Pathway
ppeo00010  Glycolysis / Gluconeogenesis
ppeo00020  Citrate cycle (TCA cycle)
ppeo00620  Pyruvate metabolism
ppeo01100  Metabolic pathways
ppeo01110  Biosynthesis of secondary metabolites
ppeo01120  Microbial metabolism in diverse environments
ppeo01130  Biosynthesis of antibiotics
ppeo01200  Carbon metabolism
Module
ppeo_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:ppeo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ABE82_14000
   00020 Citrate cycle (TCA cycle)
    ABE82_14000
   00620 Pyruvate metabolism
    ABE82_14000
Enzymes [BR:ppeo01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     ABE82_14000
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 GCV_H ATP-synt_ab_Xtn RnfC_N Transglycosylas
Motif
Other DBs
NCBI-ProteinID: ALA42551
UniProt: A0A0K2F9Q3
Position
complement(3278793..3280406)
Genome map
AA seq 537 aa AA seqDB search
MAKFEYKFPELGEGLHEGEIIKIHIKPGDKVTDEDIIMEVQNDKAVVEVPCPVNGTVQEV
FAKDGDIFNVGQVVAVIDAEGELPEQEDAPEAPAASPEPSAAAQGGAAGTARFEYKFPEL
GEGLHEGEIIKIHIKPGDKVTDEDIIMEVQNDKAVVEVPCPVNGTVQEVFAKDGDIFNVG
QVVAVIAAEGELPEQEDAPAAVKQEEDAAKGGANTKPVATPAASNKDVLATPSVRKFARE
QGVNIAQVSGSGKNGKITKEDVEAFKNGGGQAAAPVAKEAAKAQEPAKKEAKAAAPSAPA
ADPRAEEERVPFKGIRKAISNAMVKSAYTAPHVTIMDEVDVTELVAFRTRIKPIAEKKGT
KVTYLPFIVKALVAASRQFPALNATIDEEANEIVYKKYYNIGIATDTDNGLIVPVIKDAD
RKSIWMIADSIRDLAVRGRDGKLAANEMRGSTISITNIGSAGGMFFTPIINFPEVAILGT
GRISEKAVVKNGEIVAAPVMALSLSFDHRIIDGATAQNFMNYIKQLLANPELLVMEV
NT seq 1614 nt NT seq  +upstreamnt  +downstreamnt
gtggctaaatttgaatataaattcccggagctaggtgaaggtcttcacgaaggcgaaatc
atcaagattcacatcaagcccggcgacaaagtaacagatgaagatatcatcatggaagta
caaaacgataaggctgtagttgaagttccgtgtccggttaatggtacagtacaagaagta
tttgccaaagacggcgacatctttaacgtaggtcaagtcgtagctgtaattgatgcagaa
ggtgaacttcctgaacaagaagatgcaccagaagcaccagctgctagccctgaaccaagt
gctgctgcacaaggcggagctgcaggtacagctagatttgaatataaattcccagagctg
ggtgaaggtcttcacgaaggcgaaatcatcaagattcacatcaagcccggcgacaaagta
acagatgaagatatcatcatggaagtacagaacgataaggcagtagttgaagttccgtgt
ccagtcaatggtacggttcaagaagtatttgccaaagacggtgacatctttaatgtaggt
caagttgtggctgtaatcgctgcagagggcgaacttcctgaacaagaagatgcaccagct
gctgtgaaacaagaagaggatgctgcaaaaggcggagctaacacaaaaccagttgcaaca
cctgctgcttctaacaaagacgtactggctacacctagcgtccgcaaatttgctcgtgag
caaggtgtaaacatcgctcaagtgagtggctctggcaaaaatggtaaaatcaccaaagaa
gatgtagaagctttcaaaaatggtggaggtcaagcggctgcaccagtagcgaaagaagct
gcaaaagcacaagagcctgctaagaaagaagcgaaagctgcagcaccatctgcaccagca
gcagatccacgtgctgaggaagagcgcgtaccatttaaaggtatccgcaaagctatttcc
aatgctatggttaaatcggcttatacggctccgcacgttacgattatggatgaagtagat
gtaactgaactggttgctttccgtactcgtatcaaaccaattgctgagaagaaaggcaca
aaagtaacatacctgccattcatcgtaaaagctttggttgctgcttcccgtcaattcccg
gctctgaatgccacgatcgacgaagaagcaaacgaaattgtctacaaaaaatactacaac
atcggtatcgctacagatacagacaacggcttgatcgttcctgttatcaaagatgctgat
cgtaagagtatctggatgattgctgattccattcgtgatctagctgtgcgcggtcgtgat
ggaaaattggctgcgaatgagatgagagggagcacaatctcaatcactaacatcggttcc
gcaggcggtatgttctttactccaatcattaatttccctgaagttgcgattttgggtact
ggccgcatcagtgaaaaagcagtcgtgaaaaacggtgaaattgtagctgctccagtaatg
gctctttccttgagctttgaccaccgtattattgacggtgcaactgctcaaaacttcatg
aactatatcaaacagctgctcgctaaccctgagttgcttgttatggaggtgtaa

DBGET integrated database retrieval system