KEGG   Paenibacillus peoriae: ABE82_15475Help
Entry
ABE82_15475       CDS       T04053                                 

Definition
(GenBank) polyprenyl synthetase
  KO
K13789  geranylgeranyl diphosphate synthase, type II [EC:2.5.1.1 2.5.1.10 2.5.1.29]
Organism
ppeo  Paenibacillus peoriae
Pathway
ppeo00900  Terpenoid backbone biosynthesis
ppeo01100  Metabolic pathways
ppeo01110  Biosynthesis of secondary metabolites
Module
ppeo_M00364  C10-C20 isoprenoid biosynthesis, bacteria
Brite
KEGG Orthology (KO) [BR:ppeo00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    ABE82_15475
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01006 Prenyltransferases [BR:ppeo01006]
    ABE82_15475
Enzymes [BR:ppeo01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.1  dimethylallyltranstransferase
     ABE82_15475
    2.5.1.10  (2E,6E)-farnesyl diphosphate synthase
     ABE82_15475
    2.5.1.29  geranylgeranyl diphosphate synthase
     ABE82_15475
Prenyltransferases [BR:ppeo01006]
 Terpene biosynthesis
  Prenyl diphosphate synthase
   ABE82_15475
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: polyprenyl_synt
Motif
Other DBs
NCBI-ProteinID: ALA42827
UniProt: A0A0K2FAN5
Position
complement(3592072..3592995)
Genome map
AA seq 307 aa AA seqDB search
MKTAVKGLNRPSFKEYLTGTTDVVSSALIEQFPVDWNIPAVLRESMNYSLTAGGKRLRPL
LVIAAAEAFGGSREAALPVACAVEMVHTYSLIHDDLPAMDDDDYRRGKLTNHKVYGEAVA
VLAGDALLTHAFYSIVQAGRRHGVSSDALLSIVEDLSEMSGARGMVGGQVADMSGEQGMT
GIEELEYIHLHKTADLIIFSLLAGGRIGGADKSQLEALRRFGRDLGLAFQIQDDILDLIG
DESKMGKKTQSDVEQEKVTYPYFIGMDASLQQVEELTASAKKVITESGIPDSSRLLEIAD
YLMKRDH
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacggcggtgaagggcttgaatagaccgtcgttcaaggaatatttgaccgggacg
acggatgtagtttcatccgcactgatcgagcagttcccggtcgattggaacattcccgct
gttcttcgagaatccatgaattactcacttaccgcaggcggaaaacggctgcggcctctg
cttgtgatcgctgctgctgaagcattcggtggaagtagggaagctgcgctgccagtggca
tgtgcggtagaaatggtacatacgtactccctcattcatgacgacttgccagccatggat
gatgatgattatcggcgaggtaagctgacgaatcataaggtatacggcgaggcggttgct
gtccttgcgggtgatgctttgttgacccatgccttttacagcattgtgcaagcaggacgg
cgtcacggtgtttcatccgatgcgctattgtccattgtcgaggatttgtccgaaatgagt
ggcgcgcggggcatggtaggcggacaggttgccgatatgtcaggcgagcaaggaatgacg
gggatcgaggaactggaatatatccatcttcataaaactgctgatttgattattttctcg
ctcttggcaggtggacggattggtggggcggacaagagtcaattagaggcgcttcgccgt
tttggacgagacttggggctggcttttcagatacaggacgatatactggacctcataggc
gatgagagcaaaatgggtaagaaaacgcaaagtgatgttgaacaggagaaggttacctat
ccgtatttcattggtatggacgcatctttgcagcaggtggaggaactcaccgcatctgct
aaaaaagtgataacagagagcggtattcccgattcttctcgtttgctggagatagccgat
tacctgatgaagcgtgatcattag

DBGET integrated database retrieval system