KEGG   Prunus persica (peach): 18766342Help
Entry
18766342          CDS       T03092                                 

Definition
(RefSeq) putative amidase C869.01
  KO
K01426  amidase [EC:3.5.1.4]
Organism
pper  Prunus persica (peach)
Pathway
pper00330  Arginine and proline metabolism
pper00360  Phenylalanine metabolism
pper00380  Tryptophan metabolism
pper01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pper00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    18766342
   00360 Phenylalanine metabolism
    18766342
   00380 Tryptophan metabolism
    18766342
Enzymes [BR:pper01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.4  amidase
     18766342
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Amidase
Motif
Other DBs
NCBI-GeneID: 18766342
NCBI-ProteinID: XP_007201699
UniProt: M5W0Z2
Position
G8
AA seq 519 aa AA seqDB search
MAQPSLSHFSSFLLILLLFALSLGQQTAAGHGLSIKEATIDDLQLAFKHNKLTSRQLVQF
YLGEISKLNPFLKGVIEVNPDALYLAEKADYKRKTKAPSVSLSKLHGIPILVKDNIATKD
KLNTTAGSYALLGSVVPRDAGVVTKLRKAGAVILGKASLSEWSYWRSNDAPSGWSGRGGQ
GVNPYNFSTTPSGSSSGPAISAAANLATVTLGSETDGSILSPSSWNSVVGIKPTIGLTSR
AGVVPISPRQDTVGPITRTVSDAAYVLDVIAGIDSNDLATSEASRYIPKGGYAQFLRPDG
LRGKRIGIVRALFNFGSDASLTQTFEQHFNTLRKRGAVLVDNLEIAHFDEIYYNSSSEDI
ALSAEFKIYLNTYLKNLVASPVRSLADVIVFNNKNSKLEKVKEYGQGLLLKSEATNGIGN
AEKAALVNLAKLSKNGFEKLVTKKRLDAVVAPSATVSTLLAIAGSPGVVVPAGYTKDGVP
FGISFGGLRGSEPKLIEIAYGFEQATKIRKPPSLKNFKI
NT seq 1560 nt NT seq  +upstreamnt  +downstreamnt
atggcacaaccaagcctctctcacttctcatccttccttttgattcttcttctctttgca
ttgtcacttgggcaacaaacagctgcaggacatggactctcaatcaaggaagccaccata
gacgatctccaactagctttcaagcacaacaagctcacctcaaggcaacttgtccagttt
taccttggggaaatcagcaagctcaaccctttcctcaagggggtcatagaagtgaacccg
gatgcgctttaccttgccgaaaaggctgactacaagcgcaagactaaggcaccatctgtg
tcactctctaagttacatggcattcccattctggtcaaggacaacattgcaaccaaggac
aagttgaacaccacagctggctcttatgctctgcttggctctgttgtgccccgggacgcc
ggcgtggtgaccaagttgaggaaggctggggctgtcatactgggaaaggccagcttgagt
gagtggtcctattggaggtccaatgatgcaccttctggttggagtggcagaggtggccaa
ggggtgaacccttacaattttagcacgacgccaagcggctcaagtagcgggccggcaata
tcagcggcagcaaatctggcaacagtgacactggggagtgaaacagacgggtcgatttta
agtccatccagttggaactcagtggtgggcatcaaaccaacaattggccttacaagtcga
gcaggggttgttccaatctctccaagacaggacacagtcgggccaattactaggacagta
tcagatgccgcatatgttcttgatgtcattgcaggcattgacagcaatgaccttgcaaca
agtgaggcatcgaggtacattcccaagggcggctatgcacaatttctcagacctgatgga
cttagaggtaagagaatagggatagtgagagccttgttcaactttggcagtgacgcttcg
ttgactcaaactttcgaacagcatttcaacactctgaggaaaagaggtgctgttttggta
gacaatttggaaatagcacattttgatgaaatctactataattcaagtagtgaagacatt
gcattgtctgctgagttcaaaatttacttgaacacatacctcaagaacttggtggcttca
ccggttcgatccttggcagacgtgatagtcttcaacaataaaaactcaaaactggagaaa
gtgaaggagtatggccaaggcctactcttgaaatctgaagcaacaaatgggattggcaat
gcagagaaggcagcgctggtaaacttggcaaagctatccaaaaatggtttcgagaagctc
gtgacgaagaagaggctagacgcagtggtggctccatctgcaaccgtgtcgacgttgctc
gccatagcaggctccccaggagtggttgtcccagcaggatatactaaagatggggtaccg
tttggcatctcctttggcgggctgaggggttcggagccaaagctaattgagatagcatac
ggctttgagcaagccactaagattaggaagcctccttcacttaaaaacttcaagatttag

DBGET integrated database retrieval system